KEGG   Shewanella amazonensis: Sama_1375Help
Entry
Sama_1375         CDS       T00445                                 

Definition
(GenBank) Acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
saz  Shewanella amazonensis
Pathway
saz00071  Fatty acid degradation
saz00072  Synthesis and degradation of ketone bodies
saz00280  Valine, leucine and isoleucine degradation
saz00310  Lysine degradation
saz00362  Benzoate degradation
saz00380  Tryptophan metabolism
saz00620  Pyruvate metabolism
saz00630  Glyoxylate and dicarboxylate metabolism
saz00640  Propanoate metabolism
saz00650  Butanoate metabolism
saz00900  Terpenoid backbone biosynthesis
saz01100  Metabolic pathways
saz01110  Biosynthesis of secondary metabolites
saz01120  Microbial metabolism in diverse environments
saz01130  Biosynthesis of antibiotics
saz01200  Carbon metabolism
saz01212  Fatty acid metabolism
saz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:saz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sama_1375
   00630 Glyoxylate and dicarboxylate metabolism
    Sama_1375
   00640 Propanoate metabolism
    Sama_1375
   00650 Butanoate metabolism
    Sama_1375
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Sama_1375
   00072 Synthesis and degradation of ketone bodies
    Sama_1375
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sama_1375
   00310 Lysine degradation
    Sama_1375
   00380 Tryptophan metabolism
    Sama_1375
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sama_1375
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sama_1375
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Sama_1375
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:saz04147]
    Sama_1375
Enzymes [BR:saz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Sama_1375
Exosome [BR:saz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sama_1375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III PDT
Motif
Other DBs
NCBI-ProteinID: ABL99582
UniProt: A1S5C6
Position
1665719..1666897
Genome map
AA seq 392 aa AA seqDB search
MSVSDIVIVAAKRTAMGGFQGSLSEVPSPKLAATAVKALLDDTGLDGARVDELLMGCVLP
AGLGQAPARQAALGAGLPLSVGATTVNKVCGSGMKTVMLAHDLIKAGSAKVVIAGGMESM
SQAPYLLDKARGGMRMGHGKVLDHMFLDGLEDAYTGGAMGTFAQKTADDYGLTRESMDAF
ALSSLEKANAAINSGAFEAEIVPVTVSSRKGDVEVKVDEQPGNARPEKIPTLRPAFAKDG
TITAANSSSISDGAAALMLMSRDQADALGLKVLATIKGHTTHAQEPAMFTTAPVGAMTKL
LSNVGWSKDEVDLFEINEAFAMVTMLAISELKLDAARVNVNGGACALGHPIGCSGARVLV
TLIHALKARGLKRGVASLCIGGGEATAMAIEV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtatcggatatcgtcattgttgcggcaaaacgcaccgccatgggtggttttcag
ggcagcctgtctgaggtgccgtcacccaagttggccgcgactgcagtcaaggctctgctg
gatgacacaggcctggatggcgccagggttgacgaactcctgatgggctgcgtgctgcct
gcaggtcttggccaggcgccagcccgtcaggctgcactgggcgcaggtttgccgctgtca
gtgggcgccaccacggtcaacaaggtgtgtggctcaggcatgaaaaccgtgatgctggcc
catgacctcatcaaagcaggcagcgccaaggtggtgattgccggcggcatggagagcatg
agccaggccccatacctgctcgataaagcccgcggcggtatgcgcatgggccacggcaag
gtgcttgaccacatgttcctcgacggtcttgaagatgcctacaccggcggcgccatgggc
accttcgcccagaaaacggctgacgattacggcctgacccgcgagtccatggacgcattc
gccttaagctctctggaaaaagccaatgcggcgatcaattccggcgccttcgaagcggaa
atcgtgcctgtaaccgtgtccagccgcaaaggcgatgtggaagtgaaagttgatgagcag
cccggtaatgcccgtcccgagaagattccgacgctgcgcccggcctttgccaaagacggc
accatcactgccgccaactcatcgtctatctccgacggtgcagctgcgctgatgctgatg
agccgcgatcaggccgacgctctgggtcttaaggtactggccaccatcaaggggcacact
acccatgcccaggagccagccatgttcaccacagccccagtgggagccatgaccaagctg
ctctccaatgtgggctggagcaaggacgaggttgatctctttgaaatcaatgaagccttt
gccatggtgaccatgcttgccatcagtgagctcaagctggatgcggccagagttaacgtg
aacggcggcgcctgcgccctgggtcaccccataggctgctccggcgcccgagtgctggtg
accctcatccatgcgctcaaggcccgaggcctgaagcgcggcgtggcctctctgtgtatc
ggcggcggcgaagccacagccatggccatcgaagtttaa

DBGET integrated database retrieval system