KEGG   Shewanella amazonensis: Sama_1424Help
Entry
Sama_1424         CDS       T00445                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
saz  Shewanella amazonensis
Pathway
saz00020  Citrate cycle (TCA cycle)
saz00190  Oxidative phosphorylation
saz00650  Butanoate metabolism
saz01100  Metabolic pathways
saz01110  Biosynthesis of secondary metabolites
saz01120  Microbial metabolism in diverse environments
saz01130  Biosynthesis of antibiotics
saz01200  Carbon metabolism
Module
saz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
saz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
saz_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sama_1424
   00650 Butanoate metabolism
    Sama_1424
  Energy metabolism
   00190 Oxidative phosphorylation
    Sama_1424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ABL99631
UniProt: A1S5H5
Position
1733494..1733841
Genome map
AA seq 115 aa AA seqDB search
MVTNAASFGRSGVHDFILLRASAVILACYTIFLVSFIALSAPLTFEIWHGLFSTLPMKVF
TLLALIALLIHAWIGIWQVLTDYVKQTALRGVLQFTFVVTAFAYLAAGIVIVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaatgcagcaagtttcggacgcagtggtgtccatgactttatccttcttcgt
gccagtgcggtcattctggcctgctacaccatcttcttggtgagctttattgcactgagt
gcgcctctcactttcgaaatctggcacgggctgttcagcaccctgccgatgaaagtgttt
accctgctggctctgattgccctgctgatccatgcctggatcggtatctggcaagtgctg
actgactacgtcaagcaaacagcgctgcgtggtgtattacagtttacctttgtcgtgact
gccttcgcttatctggccgccggcattgtgattgtgtggggggtataa

DBGET integrated database retrieval system