KEGG   Shewanella amazonensis: Sama_1428Help
Entry
Sama_1428         CDS       T00445                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
saz  Shewanella amazonensis
Pathway
saz00020  Citrate cycle (TCA cycle)
saz00310  Lysine degradation
saz01100  Metabolic pathways
saz01110  Biosynthesis of secondary metabolites
saz01120  Microbial metabolism in diverse environments
saz01130  Biosynthesis of antibiotics
saz01200  Carbon metabolism
Module
saz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
saz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sama_1428
  Amino acid metabolism
   00310 Lysine degradation
    Sama_1428
Enzymes [BR:saz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sama_1428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: ABL99635
UniProt: A1S5H9
Position
1739373..1740575
Genome map
AA seq 400 aa AA seqDB search
MSIEIKVPVLPESVADATIATWHVKPGEAVSRDQNLVDIETDKVVLEVVAPEDGHIAEFL
AQEGDTVLAEQVIAKFVAGAVAGQEVTKAQAEAAAPAAEAASDESNDALSPSVRRLIAEH
NLDASKIKGTGVGGRITKEDVDAFVKSGAGKAAAPAAKAAAPVALSGDRSDKRVPMTRLR
KTIASRLLEAKNSTAMLTTFNEVNMKPIMDIRKQYQDIFEKKHGIRLGFMSFYVKAVTEA
LKRFPEVNAAIDGDDIVYHNYFDVSIAVSTPRGLVTPVLRDTDTMSLADIEKAVRDLAIK
GRDGKLTVEDMTGGNFTVTNGGVFGSLMSTPILNLPQSAILGMHAIKDRPMAVNGQVEIL
PMMYLALSYDHRIIDGRESVGFLVTIKEFLEDPTRLLLDI
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgaaattaaggtacccgttctgccagaatccgtggctgatgccactatcgcc
acctggcacgttaagcctggtgaggctgtatctcgtgaccagaacctggttgatatcgag
accgacaaggttgtattggaagtggttgcaccagaagatggccacatcgctgagtttctg
gcccaggaaggtgacaccgttctggccgagcaggtgattgccaagtttgtggccggtgcc
gttgccggtcaggaagtgaccaaggcgcaagccgaagccgctgcccctgctgctgaagcc
gctagcgatgagagcaacgatgcactgagcccatcagtacgccgtctgattgccgaacac
aacctggatgccagcaaaatcaaaggcactggtgtaggtggccgtatcaccaaagaagac
gttgacgccttcgtgaaaagtggtgccggtaaagctgctgctcctgcggccaaagcagct
gctccggtggcactgtctggcgatcgctcggacaagcgcgtgcctatgacccgcctgcgc
aagaccattgccagccgtctgctggaagccaaaaactctaccgccatgctgactaccttc
aacgaagtcaacatgaagcctattatggatatccgtaagcagtatcaggatatcttcgag
aagaagcacggtatccgtcttggctttatgtctttctacgtgaaagcggtaactgaagcc
ctgaagcgcttcccagaagtgaacgcggctattgatggcgatgacatcgtttaccacaac
tacttcgacgtgagcatcgctgtgtctactccccgtggtctggttacgccagtactgcgt
gacaccgacaccatgagcctggctgacatcgagaaagcagtacgcgatctggccatcaag
ggccgtgacggcaagctgactgtggaagacatgaccggcggtaacttcactgtgaccaac
ggtggtgtattcggctcgctgatgtctaccccaattctgaacctgccacagagcgctatc
ctcggcatgcacgccatcaaggaccgcccaatggcagtcaatggtcaggttgaaatcctg
cccatgatgtacctggctctttcttacgaccaccgtatcatcgatggccgtgagtctgtt
ggcttcctggtaaccatcaaggaattcctggaagacccaacccgtctgctgctggacatc
taa

DBGET integrated database retrieval system