KEGG   Shewanella amazonensis: Sama_1798Help
Entry
Sama_1798         CDS       T00445                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09792  uncharacterized protein
Organism
saz  Shewanella amazonensis
Brite
KEGG Orthology (KO) [BR:saz00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Sama_1798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DsbD_2
Motif
Other DBs
NCBI-ProteinID: ABM00004
UniProt: A1S6J7
Position
2190329..2191021
Genome map
AA seq 230 aa AA seqDB search
MDYSLSGAFLVGLMGGVHCFGMCGGLLGAFSSQIPAPPRHENPLAHRLGFLLSYNSGRIA
SYTLAGAIAGGASGGLSLLFDAGHLTLFLRFLAGLMMILLGLYVAKIWSGVVFIETLGKG
LWRVIQPFGKRLLPIDTRAKAVLAGSVWGWLPCGLVYSTLTWSVASANPLDGALIMLFFG
LGTLPALLSVGVAAKSLMGWLQRRAVRWLSGALLIAFGIQTLYIGVAQLG
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggactacagcctttcaggcgcctttttggtcggattgatgggcggagttcactgcttt
ggcatgtgtggcggcctgttgggtgccttttccagccaaatcccagcgccgccccgtcat
gaaaaccccctcgcccatcggctcggcttccttttgtcttacaatagcggccgtatcgcc
agctacactctcgctggcgccatcgccggtggtgcctcaggcggcttaagcctgctgttt
gatgcgggccatcttacgctgtttctgcgttttctggccggactcatgatgattcttctg
gggttatacgttgccaaaatctggtctggtgttgtgttcatcgaaacgctcggcaaagga
ctgtggcgtgtaattcagccttttggaaaacgccttctgcccatagacacccgcgccaaa
gccgttcttgctggcagcgtatggggctggttgccctgcggtttggtgtattccaccctg
acctggtctgtcgccagtgccaatccactggatggtgcccttatcatgctgtttttcggt
ctgggcaccttgcctgcactcctgagtgtgggcgtggcggcaaagtcgctgatggggtgg
ttacaacgccgtgctgttcgctggttatcgggtgcactgctcatagcctttgggattcaa
accttatatattggtgtcgcccagcttggctag

DBGET integrated database retrieval system