KEGG   Shewanella amazonensis: Sama_1801Help
Entry
Sama_1801         CDS       T00445                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K14058  tRNA 2-thiocytidine biosynthesis protein TtcA
Organism
saz  Shewanella amazonensis
Brite
KEGG Orthology (KO) [BR:saz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:saz03016]
    Sama_1801
Transfer RNA biogenesis [BR:saz03016]
 Prokaryotic Type
  tRNA modification factors
   Thiolation factors
    Sama_1801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP_bind_3 Thioredoxin_8
Motif
Other DBs
NCBI-ProteinID: ABM00007
UniProt: A1S6K0
Position
2192916..2193875
Genome map
AA seq 319 aa AA seqDB search
MSDVVQDELSKKQTTRLNKLQKRLRREVGSAIADYNMIEEGDRVMCCLSGGKDSYAMLDI
LINLQQRAPVSFEIVAVNLDQKQPGFPEHVLPAYLETLGVPFHILEKDTYSIVKDKIPEG
KTTCSLCSRLRRGTLYGFAQRIGATKIALGHHRDDIIETLFLNMFYGGKMKAMPPKLLSD
DGANVVIRPLAYCREKDIAEYAELKQFPIIPCNLCGSQENLKRAAVKDMLKQWDRQHPGR
IETIFTAMQNTAPSQGVDREQFDFVSLKQDPNAEFRGDVAEADLPAFDFMDTANSGHINL
DDASKRQGTRIDVVSTFTP
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtagtgcaagacgaactttccaagaaacaaactacccgcctcaacaaactt
caaaagcgacttcgccgcgaagttggcagcgctattgctgattacaacatgattgaagaa
ggtgacagagtcatgtgctgtctgtccggtggcaaagacagctatgccatgctggatatt
ctgatcaatctgcagcaacgtgcccctgtttcttttgaaattgtggccgttaacctggat
cagaagcagccaggcttccctgagcatgtgctgcctgcctaccttgagaccctgggtgtg
ccttttcatattcttgagaaagacacttattccatcgttaaagacaagatcccggaaggc
aagaccacctgttctttgtgttcacgcctgcgtcgaggcaccctgtatggatttgcccag
cggattggtgccaccaaaattgctttggggcaccacagggacgacattattgagaccctg
ttcctgaacatgttctatggcggcaaaatgaaagccatgccgcccaagctgttgtcggac
gatggtgccaacgtggttatccgccccctcgcctattgccgcgaaaaagacattgccgag
tatgccgagctgaagcagttccccattattccctgtaacctctgtggatctcaggaaaac
ctcaagcgtgctgcggtaaaagacatgcttaagcagtgggaccgtcagcatcctggtcgt
attgaaaccatctttactgccatgcagaatactgcaccttcccagggcgtcgaccgcgag
caattcgactttgtctcgctcaaacaggatcccaacgcggaatttcgcggtgatgtagca
gaagctgatttgcccgcctttgactttatggacacggcaaacagtggtcatatcaatctg
gacgatgccagcaaacgtcagggcacccgcatcgatgtggtatcgacctttaccccctga

DBGET integrated database retrieval system