KEGG   Shewanella amazonensis: Sama_1804Help
Entry
Sama_1804         CDS       T00445                                 

Definition
(GenBank) conserved hypothetical protein
Organism
saz  Shewanella amazonensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0052
Motif
Other DBs
NCBI-ProteinID: ABM00010
UniProt: A1S6K3
Position
2195616..2196524
Genome map
AA seq 302 aa AA seqDB search
MDILQFNEYRKVVAIGGGHGLGRVLSSLSFLGPRLTGIVATTDNGGSTGRLRAQHDCIAW
GDLRNCLSQLADRPSVGSLLFEYRFEGESELGGHNLGNLILYALDQLCVRPLDAVNLIRG
MLKIECKLIPMSEQPTHLVALEACGNKVFGELDVDRLESHPIALSLEPLVEPTNEACLAI
EEADLIVLGPGSFLTSTLPALLLPKVAASIRRANAKVILIDNLTAEVSSAANHLTLKERI
EWCHQLIGKPVIDRVLCHAEQEFTDGICHYQPLRSKHHQGLHDTQALAKAIMAPVGRKRL
IA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggacatattgcaattcaatgaatatcgtaaggtcgtcgcaatcggtggtggacacggc
cttggacgagtgctttccagtctttcatttcttggtcccagactgacaggcattgtggcg
accacggataacggaggctccacaggtcgtctgcgcgcacagcacgactgcattgcctgg
ggcgatcttcgtaactgcctgtctcagctggctgatagaccctctgtcggctctttgctc
tttgaatatcgatttgaaggtgagtcggagctcggtggccataaccttggcaacctcatc
ctctatgccctggaccagctgtgtgttcgtccgttggacgcagtgaatctcatccgtggc
atgctgaaaatagaatgtaaacttatccccatgtccgaacaacctacgcacctggttgca
ctggaggcctgcggcaataaggtgtttggtgaattggatgtggacaggcttgagagccat
ccaattgccctgtccctggaacccctggtcgagcccaccaacgaggcttgccttgccatc
gaagaagcggatttgattgtgctcggcccgggaagctttttgacgtcaaccttaccggca
ctgctccttcccaaagtcgcagcatcaattcgccgagcaaatgccaaagtgattttgatt
gataacctcaccgcagaggtttcctcagccgcaaaccatttaacgctcaaggagcgtatc
gaatggtgtcatcaactaataggtaaaccggttattgaccgggttttgtgtcacgctgaa
caggaattcaccgacggcatctgtcattaccagcctcttcgcagcaagcatcatcaaggt
ttgcatgatactcaggcgcttgccaaagccattatggcgcctgtgggtcgcaaacgtttg
atagcctag

DBGET integrated database retrieval system