KEGG   Shewanella amazonensis: Sama_1806Help
Entry
Sama_1806         CDS       T00445                                 

Definition
(GenBank) Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
saz  Shewanella amazonensis
Pathway
saz00010  Glycolysis / Gluconeogenesis
saz01100  Metabolic pathways
saz01110  Biosynthesis of secondary metabolites
saz01120  Microbial metabolism in diverse environments
saz01130  Biosynthesis of antibiotics
saz01200  Carbon metabolism
saz01230  Biosynthesis of amino acids
Module
saz_M00002  Glycolysis, core module involving three-carbon compounds
saz_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:saz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sama_1806
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:saz04131]
    Sama_1806
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:saz04147]
    Sama_1806
Enzymes [BR:saz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     Sama_1806
Membrane trafficking [BR:saz04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Sama_1806
Exosome [BR:saz04147]
 Exosomal proteins
  Proteins found in most exosomes
   Sama_1806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N
Motif
Other DBs
NCBI-ProteinID: ABM00012
UniProt: A1S6K5
Position
complement(2198300..2199739)
Genome map
AA seq 479 aa AA seqDB search
MSADKHLQSWQERFELAEAMQPLLGKLYRNQGVEVVVYGKPLLNASTIDIIKAHRLVRRH
VGDKLRLRESFPFIEVLSKLAVKQCKVDIGKLAVNYWRNHSDASEIEAYMASELASAIDH
ADEVEPRDVVLYGFGRIGRLLARLLIERTGRSNKLRLRAIVIRGGRAGDLEKRASLLRRD
SVHGPFNGSVEIDEENNALIANGTYIQIIYANGPEEVDYTKYGIKDALVVDNTGVWKDEA
GLGLHLKSPGAAKVLLTAPAKGNIKNIVFGVNDNDILDEDTIVSAASCTTNAITPVLKAI
NDKYGIENGHVETIHSYTNDQNLIDNYHKADRRGRSAPLNMVITETGAAKAVAKALPVLA
GRLTGNAIRVPTPNVSMAILSLNLNSETSKDDINDYLLDVALHSPLQNQIDFTNSTEIVS
SDLVGSRYAGVVDSQATIADGKRAILYVWYDNEFGYSCQVVGVMQKMLGLNHQSLPLSE
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgataaacacctgcaaagctggcaagaaagatttgaactggccgaggccatg
caacctctgctgggtaaactgtatcgcaaccaaggtgtagaagttgttgtctatggcaag
cctctgctgaacgcctctaccattgatattatcaaggctcaccgtctggtgcgtcgccac
gtgggtgacaaactgcgtttgcgcgaaagcttcccctttattgaggtgctgagcaagctg
gcagtgaagcagtgtaaagttgatatcggcaaactcgccgttaactactggcgtaaccac
agcgacgccagcgaaatagaagcctatatggcctcagaacttgccagcgccattgatcac
gctgatgaagtagaaccaagagacgtggttctttacggtttcggtcgtattggccgtctg
ttggcgcgtctgctgattgaacgtactggccgcagcaacaaactgcgtctgcgtgccatc
gttatccgtggcggccgtgctggcgatctggagaagcgtgcaagcctgttgcgccgtgat
tcagttcatggtcctttcaacggttctgttgaaatcgatgaagaaaacaatgccttgatt
gccaacggtacctacatccaaatcatctatgccaacggcccggaagaagtggattacacc
aagtatggtattaaagatgcgttggttgtagacaacactggtgtgtggaaagacgaagca
ggtcttggactgcacctgaagagcccaggagctgccaaggtactgctcactgcgcctgcc
aaaggtaacatcaagaacatcgtattcggtgtgaatgataacgatattctcgatgaagac
actatcgtctctgccgcatcttgcaccaccaacgccatcaccccggtgcttaaggccatc
aacgataagtacggtatcgaaaacggtcatgtggaaaccatccactcatataccaacgac
cagaacctgattgataactaccataaggccgatcgccgtggtcgcagcgccccgctgaac
atggttatcactgaaaccggtgctgccaaggccgttgccaaggcgctgcctgtgctggct
ggtcgtttgaccggtaacgctattcgtgttccgacgccaaacgtgtcaatggccattctg
agcctgaacctgaacagcgaaaccagcaaagatgatatcaacgactatctgctggacgtc
gcgttgcattcaccactgcaaaaccagattgatttcaccaactccactgaaatcgtgtcc
agcgacctggttggctctcgttacgccggtgtagtggactcacaggccaccatcgctgac
ggtaagcgtgccattctgtatgtttggtatgacaacgagtttggttacagctgccaggta
gtaggcgtgatgcagaaaatgctgggtctgaatcaccagtctctgcctctgtctgaataa

DBGET integrated database retrieval system