KEGG   Shewanella amazonensis: Sama_1807Help
Entry
Sama_1807         CDS       T00445                                 

Definition
(GenBank) conserved hypothetical protein
Organism
saz  Shewanella amazonensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2989 DUF1529
Motif
Other DBs
NCBI-ProteinID: ABM00013
UniProt: A1S6K6
Position
2199962..2200831
Genome map
AA seq 289 aa AA seqDB search
MFTSFAFVTGAFVLFGCDNGRNSDTICKNNPELCEDLHKDSWCRYEKGDLIRQRFILKTT
PNPTGKQIYDQLRFLEVYSKCIELASGVQHKVNVQRTNDRLRAFGISVQNLEELQESTKG
SQDPYLAYYHWSRLDDAKSLAVLIKAEKEGQISDPELLSKLAIYYLKTDAARAKKLYLDV
LGMVDADHLDPDWLLGLATASRTLGDLDGSYLYSRANIALTKQSVNEAQMLALLTGDKTK
AAMLDSEAEQLAKAVSSGNFAGSAIEKRLRAEIDTERAKIEPVAPLAQD
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtttacatcatttgcatttgtcaccggtgcttttgtgctttttggctgtgataatggc
cgaaactcagacacgatctgtaaaaataatcctgaactttgcgaagacctgcataaagac
agttggtgccgatatgagaaaggggaccttatccgccagcgtttcatcctgaaaactacc
cccaaccccacaggtaaacaaatttacgaccagctcagatttctcgaggtgtattcaaaa
tgcattgagttggcttcaggggtacaacacaaggttaacgttcagcgcaccaatgacaga
ctacgcgcctttggtataagtgtgcagaacctggaagaattacaggaatccaccaagggc
agccaagatccttacctcgcctactaccactggtcccgactcgacgacgcgaaaagtctt
gccgtgctcatcaaagccgaaaaggaaggacagatttctgatccggagcttttatccaag
ctggcgatttactacctgaagactgacgccgcccgagccaaaaaactgtaccttgatgtg
ctgggcatggtcgatgcagaccatcttgatccggactggttacttgggcttgccacagcc
tcacgcactctcggcgatttagacggcagttacctttactccagggccaacatagcgctg
accaagcaaagcgttaatgaggcgcaaatgctggcgctgctgacgggcgataagaccaag
gcggccatgcttgatagcgaagcagaacagttggccaaagcggtcagttccggaaatttt
gccggtagtgcgattgagaaacgcctgagggccgagatagatacagaacgggcaaaaatc
gagccagtcgctcctttagcacaggattga

DBGET integrated database retrieval system