KEGG   Shewanella amazonensis: Sama_1824Help
Entry
Sama_1824         CDS       T00445                                 

Definition
(GenBank) pyridoxal-5'-phosphate-dependent enzyme, beta subunit
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Organism
saz  Shewanella amazonensis
Pathway
saz00270  Cysteine and methionine metabolism
saz00920  Sulfur metabolism
saz01100  Metabolic pathways
saz01110  Biosynthesis of secondary metabolites
saz01120  Microbial metabolism in diverse environments
saz01130  Biosynthesis of antibiotics
saz01200  Carbon metabolism
saz01230  Biosynthesis of amino acids
Module
saz_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:saz00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Sama_1824
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Sama_1824
Enzymes [BR:saz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     Sama_1824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABM00030
UniProt: A1S6M3
Position
2220855..2221925
Genome map
AA seq 356 aa AA seqDB search
MSLPICTNWVANAIGKIEADFQRSADTHLIKLELPMLDGIDIYLKDESTHPTGSLKHRLA
RSLFLYALCNGWIKEGTSVIESSSGSTAVSEAYFARLLGLPFIAVMPKSTAKRKIEQIEF
YGGRCHFVEHSSEIYAESEKLAKELGGHYMDQFTYAERATDWRGNNNIANAIFGQMEREP
HPIPSWIVMSPGTGGTSATIGRYIRYQRLATKLLVVDPQHSVFYDYFKTGDAGITCEKGS
CIEGIGRPRVEPSFIPGVVDEMLKVADVDSIATMYWLEALIGRKTGPSTGTNLYGALKLA
SQMKARGETGSIVTLICDPGERYLDTYYNSDWVSSHIGDITAASTALAAFSESGKL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagcctccccatttgcactaattgggtagccaatgccatcggcaaaattgaagccgac
tttcagcgcagcgccgacacccacctgattaagctcgaattaccgatgctcgacggcatc
gatatctatttaaaagacgaaagcacccaccccaccggtagcctcaaacatcgtctggcc
cgttcattgtttctgtacgcactttgcaatggctggattaaagaaggtacgtcggtcatc
gagtcctcatccggcagcactgcggtgtctgaggcctattttgcccgcctgctcggttta
ccctttattgcggtgatgccaaagagcaccgccaagcgcaaaatcgaacaaattgagttt
tacggcggacgttgccattttgttgaacattccagcgagatttacgccgagtcagagaaa
ctcgccaaagaactgggtggccactacatggatcagttcacctacgccgaacgggccacc
gactggcgcggcaacaacaacattgccaacgctatttttggccagatggagcgcgaaccc
catcccatccccagctggattgtgatgagtcccggcaccggtggcacctcggcgaccata
ggtcgctatatccgctatcagcgcctcgccactaaattgctggtggtcgacccgcagcac
tcggtgttttacgactacttcaaaaccggtgacgccggtattacctgtgaaaaaggcagc
tgtattgaaggcattggtcgccccagggtggagccttcctttattccaggcgtggtggat
gagatgcttaaagtcgcggatgtggactccatcgccaccatgtattggctcgaagcctta
atcggccgtaaaaccggcccctctacaggcactaacctctatggcgcactgaaactggct
tcccaaatgaaggcccgcggcgaaaccggcagtatcgttacgcttatctgcgatccgggc
gaacggtatctggatacctactacaacagcgactgggtaagttcgcacattggcgatatc
acggcagcaagtacggcgcttgccgccttcagtgaaagtggcaagctgtga

DBGET integrated database retrieval system