KEGG   Shewanella amazonensis: Sama_1832Help
Entry
Sama_1832         CDS       T00445                                 

Definition
(GenBank) iron-sulfur cluster-binding protein
  KO
K03615  electron transport complex protein RnfC
Organism
saz  Shewanella amazonensis
Brite
KEGG Orthology (KO) [BR:saz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    Sama_1832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Complex1_51K RnfC_N SLBB Fer4_10 NQRA Fer4_8 Fer4_7 Fer4_9 Fer4_17 Fer4_4 Fer4_21 Fer4 Fer4_22 Fer4_2 Fer4_16 Fer4_6 Fer4_18 NQRA_SLBB
Motif
Other DBs
NCBI-ProteinID: ABM00038
UniProt: A1S6N1
Position
2230826..2233468
Genome map
AA seq 880 aa AA seqDB search
MLTLLEQLDKGTLWRSPGGIHPPEMKSVSNGTAIATLPLFDEYLVPLPQVGEQAILAVKV
GDTVLKGQMLTQGQGVGYLPVHAPTSGRVKAIESRPSNHASALPILTLALEADGQDKWCE
LQSAALDALTPAQMVKRIQDAGIAGMGGAAFPSHIKLSPASEIELVIVNGVECEPYITAD
DRLMREHADGIVAGIGIVHRILAPKRIIIAIEDNKPEAAEAMQAAVNRSQLPAGLVRVTV
IPTKYPSGGEKQLIQIVTGQEVPSGAIPAQLGILVHNVGTLFAIRDAVIEGKPLIERVVT
VTGNAVTKPGNYWTLIGSKVEDVLRHCDFREAEAQKIIMGGPMMGYTLANTQVPILKGSN
CLLLPNGLEITEMPPEKPCIRCGECAVACPASLLPQQLFWHAKAEEYDKAQSYNLKDCIE
CGCCTYVCPSDIPLVEYYRVAKAAIRQQAEEKASAERAKVRFEARITRLEEEKAAREAKA
KEAAEKRKAAMAGGEKDAIAAALARVQAKKAAQEQNAAPVAASPEGAQASAADPKAGVAA
AIARAKAKKTAQQEAAKSPDTAGSTVTDAASDLSIETTPEQESTPASSEDPKKAAVAAAI
ARAKAKKAAQAANSNTAATDTANGNRQVSSLQEPKVQASAVQPPESQAQEQDPKRAAVAA
AIAKAKAKKSARNTDESGLAVAEPSAPATGEAESAPADDKSARVAAAVAKAKAKKLAASA
SDSPFPEDMAAIPEKNRSEASLVQTDESLPETRGDDKPDNKAARVAAAVAKAKAKAAARR
EEAQPDPAVAEHIQSETSQAADADELETDIQAPEKSTLTDMATAMPPAANQIPEQGVHIA
DSANTAASEVPPTDADTLKKARIAAAVAKAKAKKAAKEHE
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
gtgctgacgcttttggaacaattggataaaggtacgctgtggcgctcacccggtggcatt
cacccacccgagatgaaatccgtctccaatggcaccgctatcgccacactgccactgttt
gatgagtacctggtacccctgcctcaggtcggtgaacaggccattctcgccgtaaaagtg
ggagatactgtacttaaagggcagatgctgactcagggccagggagttggctatctaccg
gtacatgcccccacctcaggccgcgtcaaagccattgaatcacgcccgagcaaccatgcc
tctgcgctgcccatactgaccctggcattggaagccgatggccaggacaaatggtgtgaa
ctccaaagcgcggctttggatgcgttgacccctgcccaaatggtcaaaaggatacaggat
gccggcatcgccggtatgggcggcgctgcgtttccaagccacattaaattaagtccggcg
agcgaaattgagctggtgatagtcaatggcgttgaatgtgaaccctacattaccgctgac
gatcgccttatgcgcgagcacgccgatgggatagtcgctggtatcggtatagtgcaccgt
atccttgcacccaaacgcattatcatcgccatcgaagacaacaagcccgaagccgctgaa
gccatgcaggctgccgtcaatcgcagccagttaccggcaggacttgtcagggtcactgtt
atcccgaccaaatacccttcaggcggtgaaaagcagctcattcagatagtgactggccag
gaagtgccctccggcgctattcctgcgcagctcggtatcctggtgcacaacgtcggtacc
ctgtttgcaatccgggatgccgtcatcgaaggtaagccactgatagaaagagtcgtcact
gtcaccggcaatgcagtaaccaaacccgggaactactggactttaataggcagcaaggta
gaggatgtcctccgccactgtgattttcgtgaagcagaggcccaaaaaatcatcatgggt
ggccccatgatgggatataccctggccaatacccaggtaccgattttgaaaggcagcaat
tgtctgctgctgcccaacggcctcgaaatcaccgagatgccgcctgaaaaaccctgcatt
cgctgcggcgaatgtgccgttgcctgccctgcgtccttgctgccgcagcaactcttttgg
cacgccaaggcggaagaatacgacaaggcacaaagctataaccttaaagactgtatcgag
tgcggatgttgcacttatgtctgccccagcgatatcccgctggtagagtattatcgggtg
gccaaagccgccattcgccagcaggcggaagaaaaagccagtgctgagcgtgccaaggtg
cgatttgaagcgcgcattacccgccttgaagaagaaaaagcggcccgtgaagccaaggca
aaagaggcggcggaaaaacgtaaagcggccatggccggtggagaaaaagacgccatcgct
gccgccctcgcccgggtacaggccaaaaaagccgcccaggaacaaaatgccgctccggtc
gctgcctcaccagagggggctcaagcttcagcggcggatccaaaagccggggttgctgcc
gccatcgccagagccaaagccaaaaagacagcccaacaggaagcagccaagtcccccgat
acagcgggcagcactgtgaccgatgctgcttcagacctgtctatcgagacgacgcctgag
caggagtcaacgcccgcaagcagtgaagatccgaaaaaggccgctgttgccgcagcgatt
gcccgcgccaaggcaaaaaaggcagcgcaggcggcaaacagcaatacagcggctacagac
accgctaacggtaatcgccaggtatcctccttacaggagccaaaagttcaggcatcagca
gtacagccacctgaatcacaggcgcaggagcaggatcccaagcgagctgctgtggcagcc
gccatcgccaaagcgaaagccaaaaagtctgcccggaatacggatgaaagcggcttggct
gtggcagaaccgtccgcaccagcgaccggggaggcagaatcagccccagcggatgacaaa
tcagcaagagttgccgcagcggttgccaaagccaaggcgaagaagttggcggcaagtgct
tctgacagcccattcccagaggatatggccgctattcctgaaaagaatcgcagtgaggca
agcctcgtacaaacagatgaaagtcttcctgagaccaggggagacgataagcctgacaac
aaagccgccagagtggccgctgcggttgccaaagccaaggcaaaggctgcggccagacgt
gaagaggcacagccggatccagctgtggctgaacacattcaatctgaaacgtctcaagcg
gccgacgccgatgaacttgagactgacattcaggcaccagagaaaagtaccttaaccgac
atggccacggccatgccgcctgcagcaaaccaaataccagagcaaggtgttcacatcgca
gacagcgcaaacactgctgcttcagaggttccaccaaccgatgccgatacgctcaaaaaa
gcccgtattgctgcggctgtcgccaaagccaaggcaaaaaaagccgccaaggagcatgaa
taa

DBGET integrated database retrieval system