KEGG   Shewanella amazonensis: Sama_1837Help
Entry
Sama_1837         CDS       T00445                                 

Definition
(GenBank) Lactoylglutathione lyase
  KO
K01759  lactoylglutathione lyase [EC:4.4.1.5]
Organism
saz  Shewanella amazonensis
Pathway
saz00620  Pyruvate metabolism
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sama_1837
Enzymes [BR:saz01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.5  lactoylglutathione lyase
     Sama_1837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase Glyoxalase_4 CppA_N
Motif
Other DBs
NCBI-ProteinID: ABM00043
UniProt: A1S6N6
Position
2236858..2237268
Genome map
AA seq 136 aa AA seqDB search
MSQILHTMVRVANLEKSIAFYTEVLGMTLLRTSENPEYRYSLAFVGYGEEAKGAAVIELT
WNWDTDKYELGTGFGHIAIGKADIYKACEDIAKAGGKVTRAPGPVAGGTTEIAFVEDPDG
YKIELIQMKSAMQGLG
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaattcttcataccatggttcgggttgccaatcttgagaaatccatcgccttc
tacactgaggtgctgggcatgacgctgcttcgcacctcagaaaatcctgagtatcgttat
tcactggcttttgtgggctatggcgaagaagccaagggcgcggccgtcattgagctgacc
tggaactgggataccgacaagtacgaacttggcactggctttggccatatcgccatcggt
aaagcagatatttacaaggcctgcgaagacatcgccaaggccggcggtaaagttacccgc
gcgcctggtcctgttgccggtggcactacggaaatcgccttcgttgaagaccccgatggt
tacaagattgaactcatccagatgaaatctgccatgcaaggccttggctga

DBGET integrated database retrieval system