KEGG   Shewanella amazonensis: Sama_1840Help
Entry
Sama_1840         CDS       T00445                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
saz  Shewanella amazonensis
Pathway
saz03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:saz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Sama_1840
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:saz03400]
    Sama_1840
Enzymes [BR:saz01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Sama_1840
DNA repair and recombination proteins [BR:saz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Sama_1840
    RecFOR pathway proteins
     Sama_1840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH IMS_HHH HHH_8 5_3_exonuc HHH_3 UBA
Motif
Other DBs
NCBI-ProteinID: ABM00046
UniProt: A1S6N9
Position
complement(2241369..2241986)
Genome map
AA seq 205 aa AA seqDB search
MIGRLKGILVEKHAPEVLIDVGGVGYELQMPLTSFYELPLPGAEVIVYTHFVVREDAQLL
YGFIHKEERSLFRLLIKANGVGPKLALTILSGMTAKEFIGCLERDDIATLIKLPGVGKKT
AERLLVEMRDKLKSLMEASMGAEREFVLKSNFTPAPVAATVEEDAIAALLSLGYKPQQAS
KAVSSAFQEGMDPEQLIKAALKSML
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgataggtcgtttaaagggcattttggttgagaaacacgccccagaggtattgatagat
gtgggcggtgttggctatgagctgcaaatgccgctgacctccttttacgagctgccactg
cctggcgccgaggtcattgtttatacccattttgtggtccgtgaagatgctcagcttttg
tatggatttatccataaagaagagcgctcactgtttcgtttgctgatcaaggccaatggt
gttggccccaagctcgcgctcactattctgtcgggcatgaccgccaaagagtttattggt
tgcctggaacgtgacgatatcgcgaccctgattaagctgcccggtgtgggtaaaaagact
gccgaacgtctgctggttgagatgcgcgacaaactcaagagcctgatggaagcctccatg
ggcgctgagcgagagtttgtgcttaagagcaacttcacaccggcgccggtggctgccact
gtggaagaagatgccatagccgcgctcttgtcattgggctacaaaccgcagcaggcaagc
aaagccgtatccagtgccttccaggagggcatggatcccgagcagcttatcaaggctgca
cttaagtccatgctctaa

DBGET integrated database retrieval system