KEGG   Shewanella amazonensis: Sama_1841Help
Entry
Sama_1841         CDS       T00445                                 

Definition
(GenBank) crossover junction endodeoxyribonuclease RuvC
  KO
K01159  crossover junction endodeoxyribonuclease RuvC [EC:3.1.22.4]
Organism
saz  Shewanella amazonensis
Pathway
saz03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:saz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sama_1841
Enzymes [BR:saz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.4  crossover junction endodeoxyribonuclease
     Sama_1841
DNA repair and recombination proteins [BR:saz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Sama_1841
    RecFOR pathway proteins
     Sama_1841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvC DUF3882 MCR_beta_N
Motif
Other DBs
NCBI-ProteinID: ABM00047
UniProt: A1S6P0
Position
complement(2241983..2242504)
Genome map
AA seq 173 aa AA seqDB search
MAIILGVDPGSRITGYGVIQCQGRHQLYLGSGCIRTSSDELPDRLKQIFDGLQEIIRQYQ
PSQFAIERVFMAKNADSALKLGQARGAAIVAATVAGLPVAEYSATQIKNAVVGTGRAQKA
QVQHMVQQMLKLPAAPQADAADALAVAMCHYHTHQSLVALGGRASVRTYGRYR
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggccattattttaggagtcgacccgggctcacgcatcacaggttatggggttatccag
tgtcagggcaggcatcagctctatcttggcagcggttgtattcgtacttcatcggatgaa
ctgcccgacaggcttaagcagatttttgatggtctgcaggaaattatccgtcagtaccag
ccgagccagtttgccatcgagcgggtctttatggccaagaatgccgactcggcattgaag
ctaggccaggcgaggggcgctgccatagtcgccgccacagtggcaggtttgccggtggcg
gaatacagcgccacccagattaaaaatgccgtggtgggcacaggccgggcacaaaaggct
caggtgcagcacatggtgcagcagatgctgaaactccccgcagcgccccaggccgacgcg
gcagatgcactggcggttgccatgtgtcattatcacacccatcaaagtctggtggccctc
ggtgggcgcgccagtgtcagaacatacggaagatacagatga

DBGET integrated database retrieval system