KEGG   Shewanella amazonensis: Sama_1845Help
Entry
Sama_1845         CDS       T00445                                 

Definition
(GenBank) methyltransferase, putative
  KO
K15256  tRNA (cmo5U34)-methyltransferase [EC:2.1.1.-]
Organism
saz  Shewanella amazonensis
Brite
KEGG Orthology (KO) [BR:saz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:saz03016]
    Sama_1845
Enzymes [BR:saz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     Sama_1845
Transfer RNA biogenesis [BR:saz03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    Sama_1845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_12 Methyltransf_11 Methyltransf_31 Methyltransf_23 Ubie_methyltran Rsm22 Methyltransf_2 CheR Methyltransf_18 PrmA UPF0020 MTS PCMT CBF_beta FtsJ CMAS
Motif
Other DBs
NCBI-ProteinID: ABM00051
UniProt: A1S6P4
Position
2248292..2249023
Genome map
AA seq 243 aa AA seqDB search
MTNQQDTLFAEPGEHQGNFQFDSRVAGVFGDMIRRSVPGYTQIINTIGEIADRCVTPGSN
VYDLGCSLGAATLAIRRKIEGRNARIFAIDNSEPMLVRAEENLSAYVSDTKVFFQLADIR
DQTFENASLVVLNFTLQFLPPDDRDTLLARIYQGLNPGGILLLSEKLKFDGVDVQALLDS
LHLDFKRANGYSELEISQKRSAIENVLIPDTLEQHKTRLNQAGFTQADLWFQCFNFASMV
AIK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatcaacaggacacactgttcgccgagccaggcgagcatcagggtaacttccag
tttgacagtcgcgttgccggtgtatttggcgacatgatccgccgctcagtgcccggttac
acgcaaatcattaacacgattggtgaaattgctgaccgctgcgtcacgccaggctccaat
gtttatgatctgggctgttctctgggagccgcgactcttgccatccgccgcaaaatcgaa
ggtcgcaatgcgcgcatttttgccatcgataacagcgagcctatgttggtacgggctgaa
gaaaacctctccgcttacgtgagcgacaccaaagttttctttcagctggctgatattcga
gatcaaacgtttgaaaatgcctctctggtggtgctcaactttaccctgcagtttttgccg
ccagacgacagagacaccctgctggcacgcatctatcagggacttaaccccggcggtatc
ctgctgctgtctgaaaaactcaaatttgacggcgtcgatgtccaggcattactggactcg
ctgcatctcgatttcaaacgggcaaatggttatagcgaactggaaatcagtcaaaaacgc
agcgccattgagaatgtactgatccccgacacgctggaacagcacaaaacccgactgaac
caagccggcttcacccaggctgacctttggttccaatgttttaattttgcatctatggtg
gctatcaagtga

DBGET integrated database retrieval system