KEGG   Shewanella amazonensis: Sama_1870Help
Entry
Sama_1870         CDS       T00445                                 

Definition
(GenBank) oxidoreductase, acyl-CoA dehydrogenase family
  KO
K06445  acyl-CoA dehydrogenase [EC:1.3.99.-]
Organism
saz  Shewanella amazonensis
Pathway
saz00071  Fatty acid degradation
saz01100  Metabolic pathways
saz01212  Fatty acid metabolism
Module
saz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:saz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Sama_1870
Enzymes [BR:saz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.-  
     Sama_1870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1974 Acyl-CoA_dh_N Acyl-CoA_dh_1 Acyl-CoA_dh_M FAD_binding_5
Motif
Other DBs
NCBI-ProteinID: ABM00076
UniProt: A1S6R9
Position
2278706..2281153
Genome map
AA seq 815 aa AA seqDB search
MTTLLWSIALLVVLGACAYLRVSLLTATAAAAIMLTAGWTLDVVGLWGGIIFLIIALPLN
ISSIRQSLITRPLLKVYRGIMPEMSSTEKEAIDAGTTWWEADLFAGNPNWKKLHNYPTAR
LSAEEQAFIDGPVNEVCRMVNEHQVSHQFADLPADVWQYLKDNGFFAMIIKKKYGGLEFS
AYAQSRVLQKLAGVSSELASTVGVPNSLGPGELLQHYGTAEQQDHYLPRLAKGLEVPCFA
LTSPEAGSDAGSIPDYGVVCKGMWKGEEVLGMKLTWNKRYITLAPIATVLGLAFKLRDPE
RLLGGEEELGITCALIPTDVEGVETGRRHFPLNCMFQNGPTRGKDVFVPLSFIIGGPKMA
GQGWRMLVECLSVGRGITLPSNSAGGVKTAALATGAYARIRRQFKLPIGKLEGIEEPMAR
IGGNAYLMDAVTSLTTTGIDLGEKPSVISAIVKYHLTDRMQKCVIDAMDIHGGKGVCLGP
NNYLGRGYQAAPIAITVEGANILTRSMIIYGQGAIRCHPYVLAEMDSAFDKDVRQGLNKF
DAALFGHIGFTISNLIRSVWMGLTGSRFSNAPYGDKTKRYYQHMNRFSANLALLSDLAMA
TLGGNLKRKERISARLGDMLSQLYLASATLKRYQDEGRQTEDLPLVQWAVEDALFKLQAS
LDELLDNFPAGLGGVLRVLLLPFGRPLKRPSDVLDHKVAKIMQTPCASRERLGQGQFWEA
CDNNPVGVQEQTFKDILAAEPLYDKVCKAAGKRLPFMWLDQVAAEGKALGILSDAEIALL
EKAEIGRMKSINVDDFDPAELVAQTTTGKSQEQAA
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
gtgactaccctactttggagtatcgcgctgcttgtggtgcttggtgcctgcgcttatttg
cgggtgtcattgctgaccgccacggccgcagccgccattatgttgaccgcaggatggacc
ttggatgttgttggcctttggggcggcatcatctttttgattatcgcccttcctctgaat
atcagcagtattcgtcagagcctgatcacccgcccgctgctgaaagtttaccgaggcatc
atgcccgagatgtcttccactgaaaaagaagccatcgacgccggtaccacctggtgggaa
gccgatctgttcgccggtaatcctaactggaagaagctgcacaattacccgaccgcccgc
ctttctgccgaagaacaggcctttatcgacggcccggttaacgaagtgtgccgcatggtg
aacgagcatcaggtatcccatcagttcgctgacctgcctgctgacgtgtggcagtacctg
aaagacaacggcttcttcgcgatgatcatcaagaagaagtacggtggtcttgagttctcc
gcctacgcccaatcccgcgtactgcaaaagctggctggtgtttccagcgagctggcatcc
accgtgggcgtaccaaactccctcggccctggtgaactgttgcagcactacggtacggcc
gagcagcaggaccactacctgccacgtctggccaagggtcttgaagtaccttgttttgcc
ctgaccagcccggaagccggttctgatgcaggctcaattcctgactacggtgttgtctgc
aaaggcatgtggaaaggtgaagaagtgctgggtatgaagctcacctggaacaagcgctac
atcaccctggctcctatcgcgactgtgcttggtctggcgttcaaactgcgtgaccctgag
cgtctgcttggcggcgaagaagagctcggcatcacctgtgcccttattcctaccgatgtg
gaaggcgtggaaaccggtcgtcgtcacttcccactcaactgtatgttccaaaacggccca
acccgcggtaaagacgtgtttgtgcccttaagctttatcattggcggcccgaaaatggcc
ggtcagggctggcgtatgctggtggaatgtttgtcggttggccgcggcattaccctgcca
tccaactctgccggtggcgtgaaaactgctgcactggcaaccggcgcctatgcccgcatc
cgccgacagttcaagctgcctatcggtaagctggaaggtattgaagagccaatggcgcgc
atcggcggtaacgcctatctgatggacgctgtgacctcgctgaccaccacaggtatcgat
ctgggtgaaaagccatcggttatctcggccatcgtgaagtatcacctcaccgatcgtatg
cagaaatgcgtaatcgacgccatggacatccacggcggtaaaggcgtgtgccttggcccc
aacaactacctgggccgtggttatcaggctgcgcctattgccattaccgtggaaggcgcc
aacatcctcacccgctctatgatcatctatggtcagggcgccattcgctgccatccatac
gtactggccgaaatggactctgccttcgataaagacgtgcgtcagggcctgaataagttc
gatgcggctctctttggccatatcggctttactatcagcaatctgattcgcagtgtgtgg
atgggcctgactggcagccgcttctctaacgcgccatacggcgacaagaccaagcgctac
taccagcacatgaaccgtttcagtgccaacctggcgttgctgtctgatctggccatggcc
accctgggcggaaacctgaagcgtaaagagcgtatctctgcccgtcttggcgatatgctc
agtcagctgtatctggcctccgccaccttgaaacgttatcaggatgaaggccgtcaaact
gaagatctgccgctggtacagtgggcggttgaagatgccctgttcaaactgcaagcctct
ttggatgagctgctggacaacttccctgccggtctgggcggcgtgctgcgcgtattgctg
ctgcctttcggtcgtccactgaagcgtccaagcgatgtactggaccacaaggttgccaaa
atcatgcaaaccccttgtgccagccgtgagcgtctgggtcagggccagttctgggaagcc
tgcgacaacaaccctgtgggtgttcaggaacagactttcaaggacatccttgccgctgag
cccctgtacgacaaggtatgcaaagctgccggtaagcgtctgcccttcatgtggctggat
caggtggctgccgaaggtaaggcactgggcattctgtctgatgccgagatcgccctgctg
gagaaagccgagattggccgtatgaagtctatcaacgtagacgacttcgacccagccgag
ctggtggcgcaaaccaccactggcaagtctcaggagcaagcggcgtaa

DBGET integrated database retrieval system