KEGG   Shewanella amazonensis: Sama_1884Help
Entry
Sama_1884         CDS       T00445                                 

Definition
(GenBank) Hydroxyacylglutathione hydrolase
  KO
K01069  hydroxyacylglutathione hydrolase [EC:3.1.2.6]
Organism
saz  Shewanella amazonensis
Pathway
saz00620  Pyruvate metabolism
Brite
KEGG Orthology (KO) [BR:saz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sama_1884
Enzymes [BR:saz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.6  hydroxyacylglutathione hydrolase
     Sama_1884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAGH_C Lactamase_B Lactamase_B_2 Lactamase_B_3
Motif
Other DBs
NCBI-ProteinID: ABM00090
UniProt: A1S6T3
Position
2299143..2299919
Genome map
AA seq 258 aa AA seqDB search
MLDIRPIPAFADNYIWMIVLPDGGAVVVDPGDAMPVINTLQRLNLQLTAVLLTHHHRDHN
GGINQLRDWAKSNGQSFTVYGAVTSDYSDVLCRDGDTVDISGLTSPVRVLSVPGHTLDHL
AFVVDNALFCGDTLFSGGCGRLFEGDAGQLYDSLAKLASLPDDTLVYCAHEYTLSNLRFA
LAVEPQNQCLQDYVKQVNNLREANKPSLPSTLGTEKAINPFLRVDTATVHAAVAAQAGQK
VPDEVTCLALLRRWKDNF
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgttggatattcgccccattcccgcgttcgcggacaactacatttggatgattgtactg
cctgatggtggtgctgttgtggtcgacccaggcgatgcaatgcctgtgataaacaccctc
caacgcttgaacctgcaattaactgcggtgcttttgacccatcaccatagagatcataat
ggtggcataaaccaactacgtgactgggcaaagtcaaatgggcaatcgttcactgtctat
ggcgctgtaacctccgattacagtgacgttctttgccgtgacggcgatactgtcgacatt
tcgggcttgaccagccctgtcagagtactgtcggtgccgggccacacactggaccacctg
gccttcgtggtagacaacgcccttttttgtggagacaccctgttcagtggcggatgtggc
cggttatttgaaggtgatgcgggtcaactttacgattcactggcaaagttagcatctctt
cccgatgacaccctcgtttattgtgcccacgaatataccctctccaatctgaggtttgcg
ctggcagtggagccacaaaatcaatgtcttcaggattacgttaagcaggtgaacaaccta
cgtgaagccaacaagccttcactgccaagcacccttggaaccgagaaggcaatcaaccct
tttttgagggtagatacagcaactgttcacgccgctgtcgcggcacaagctggacaaaaa
gtgccagatgaagtgacctgcctcgcccttttgcgccgttggaaagacaatttttaa

DBGET integrated database retrieval system