KEGG   Shewanella amazonensis: Sama_1887Help
Entry
Sama_1887         CDS       T00445                                 

Definition
(GenBank) AsmA protein
  KO
K07289  AsmA protein
Organism
saz  Shewanella amazonensis
Brite
KEGG Orthology (KO) [BR:saz00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    Sama_1887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AsmA AsmA_2 DUF2948 DUF748
Motif
Other DBs
NCBI-ProteinID: ABM00093
UniProt: A1S6T6
Position
complement(2302542..2304356)
Genome map
AA seq 604 aa AA seqDB search
MKLIKWIFAGIAAIAVLVVLYITLIFDPNDFKPMLVDAVKEQTGRDLVIEEPLSWQFFPS
IGIRLAGVSLSNPEGFKEAHMMAVKEVVAEVKLLPLLSRDVQIDQLRLDGAKLTLVTTKQ
GKSSLDGLTGNTTSADKPADVKQGPGLNAISIGGINISDTSITLIDEAAGSSQTFTLSSL
TLGEFTPGKAAPLAFAFGADLPDMKVKGEGEATLTVSEAFNALSLVGLNLEVNAQGNSLP
KGAVTVEFAGGADVALEAKTAKLTVDKLTLMDIEGKGAIAANYGKKVPFVDVELAFGAID
VDAILGTEKSQTKADSTAPDTAQKEPDLSGMKAVDAKLKLDIAAVKVAGLSTADWALRAN
LAGGVLKVDELKASLYGGKVGASATLDGRKVPAVYSFNKAITGVQILPLLKDAAEVDLLA
GTANFDIQGKGAGLLADNIKRNLNANGKFEVADGALYGVNVPQMIRDAQAKLKGDLNAAA
GGEEKKTDFSSLTGSLNIAAGKANNPDLLMLSPLLRISGQGGADLMAETLDYKLATKVVG
SLEGQGGDTALAGIEIPLAITGSFTEPKFALDTEALLKGQLKGETDKLKDKLKDSLFKKL
GGNQ
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgatcaaatggatcttcgctggcatcgctgcgattgccgtcttagtggtgctg
tacattactctcatatttgaccccaatgattttaaacccatgctggtggatgctgtaaaa
gagcagacaggtcgcgaccttgttattgaagagccgctgtcatggcaatttttcccctct
attggcattcgtctggcgggggtgagcctgtctaaccccgaaggctttaaagaagcccat
atgatggcggttaaagaggtggttgccgaggttaaacttctgcccctgctcagccgggat
gtacaaatcgatcagttgcgtctcgacggcgccaagttaaccctggtcaccaccaagcag
ggcaaatcaagcctcgatggcctgactggcaacaccacatctgctgataaaccggcagac
gtaaagcagggcccggggctcaatgccatcagcattggcggaataaacatcagtgatacc
agcattaccctaattgatgaagccgctggcagcagccaaacctttacgctgtcgtcatta
acactgggtgagtttacccctggaaaagccgcaccactggcatttgcgttcggcgctgat
ttgcctgatatgaaggtaaaaggtgagggtgaggcgacactgacggtgagtgaagctttt
aatgccttgtcacttgtcggattgaatttggaggttaatgctcagggcaactcgctgcca
aagggcgctgtaacagttgagtttgccggtggagccgatgtggcattggaagccaaaacc
gccaaactgaccgtggataaactaaccctgatggacattgaaggcaaaggcgccattgca
gcaaactatggcaaaaaagtgccttttgtggatgttgagctggcctttggtgcaatcgat
gtcgacgccattctcggtaccgaaaagtcgcaaaccaaggcagattcgaccgcacccgat
accgcgcagaaagagccggacttgtccgggatgaaggccgttgatgccaaactcaaattg
gacattgccgccgtgaaagtggcaggtctgtctactgctgattgggcactcagagccaat
cttgccgggggcgtgcttaaagtcgatgaactcaaagcatccctgtatggcggcaaagtg
ggggcgagcgccaccctcgatggccgcaaagtaccggcggtctatagctttaataaagcc
atcactggcgtacagatattgccactactgaaagatgctgccgaagttgatttgcttgca
ggtacggccaactttgacattcagggtaagggcgcaggtttgctggcagacaacatcaag
cgcaacctcaatgccaatggtaagtttgaagtggccgatggtgcgctctatggtgtgaac
gtgccacaaatgatccgtgatgcacaggccaagctcaaaggtgatttgaatgcggccgcc
ggtggcgaagagaagaagactgatttctcaagccttacaggttctttgaatatcgccgca
ggaaaagccaataatcctgatttgttgatgctctcaccgctactgcgaatttccgggcag
ggcggcgcagatcttatggccgaaaccctcgactataagctcgccaccaaggtggttggc
tcactggaaggacagggcggtgatacggcgttggcaggcatagaaattccgctcgctatt
accggcagctttaccgagcccaaatttgccctggataccgaggctctgctcaaaggccaa
ctgaagggcgagactgataaactcaaagataagttgaaagattccctgttcaaaaagttg
ggaggtaatcaatga

DBGET integrated database retrieval system