KEGG   Shewanella amazonensis: Sama_1889Help
Entry
Sama_1889         CDS       T00445                                 

Definition
(GenBank) conserved hypothetical protein
Organism
saz  Shewanella amazonensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Endosulfine IF2_N FapA
Motif
Other DBs
NCBI-ProteinID: ABM00095
UniProt: A1S6T8
Position
2305038..2305358
Genome map
AA seq 106 aa AA seqDB search
MTTDIDLQRAIAALDEYGYDKKLSTDLEQARNKQQMRKYLDSLDYSLRRMELLQESVNEW
VAERKALLAQQENIQTYKTKIINLSKELNLSYNEVLEIMSKLDSKN
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccgatatagatttgcaacgtgcaattgccgcgctggatgaatatggctacgac
aaaaagctttcaacggatcttgagcaagcaagaaataagcaacagatgcgcaaatatctg
gactcactcgactatagcctgcgccgcatggaactgttgcaggagtcggtaaacgaatgg
gtcgctgaacgtaaagcactgttagctcagcaagaaaatatccaaacctataaaaccaaa
attattaacctctccaaagaactgaatctttcctataacgaagtgttggagataatgagc
aagctggatagcaaaaactaa

DBGET integrated database retrieval system