KEGG   Shewanella amazonensis: Sama_1902Help
Entry
Sama_1902         CDS       T00445                                 

Definition
(GenBank) Exodeoxyribonuclease V
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
saz  Shewanella amazonensis
Pathway
saz03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:saz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Sama_1902
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:saz03400]
    Sama_1902
Enzymes [BR:saz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Sama_1902
DNA repair and recombination proteins [BR:saz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Sama_1902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Helicase_RecD Viral_helicase1 AAA_11 AAA_22 UvrD_C UvrD-helicase DUF2075 AAA_16 AAA_28 Mg_chelatase NTPase_1 AAA_29 Flavi_DEAD T2SSE TrwB_AAD_bind PhoH SRP54
Motif
Other DBs
NCBI-ProteinID: ABM00108
UniProt: A1S6V1
Position
2325741..2327636
Genome map
AA seq 631 aa AA seqDB search
MIELSGKPCSSDALKAQLKLWQSQGELSALDRHFALQMAELHSDDSPLMLLMCVLVSRQL
SRQHPCLDLSALMLGNPMGTRQAQLRILADYPALLGAVANLDAVGSPDENKPLILEGKRL
YLKRYQGFESRVAARLNAMAGTELSTHAHTAALLEALFPVGKEAIDWQKIAVATAAGKQL
TVITGGPGTGKTTTVTKLLLLLSLSSSLNIRMVAPTGKAAARLSESIKASKQRLTQELNS
PLISQDAIASLPEDASTLHRLLGFQPGNHKFRHHRDNPLDLDLLLVDEASMVDLPMMDRL
LDALPGHARLILLGDQDQLASVEAGAVLADICEGARQGYRYSAVQTARIEGLTGTKLAPR
ADAPGLGDNLCRLLHSHRFAEDAGIGQLAMAVNEGDKEKVAAVWQKNYAELSWIPGDNSD
GLAALVQLAKSAYSEYLQAMKQQAEPKTILQKYNEFRVLCAMKNGEYGVDGINRAITAAL
ARAGLIEPSQEFYAGRPVMIQSNDYSLGLFNGDIGILLPVEGDNQRLMTHFIQSDGQVLK
VLPARLPGHETCYAMTVHKSQGSEFASVALSLPPQPTPSQQSLIGRELIYTAITRAKSKF
TCLGTEALFEAATQRRTERASGLADRLWHED
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgatagaactttcaggcaagccctgtagcagtgatgccctcaaagcgcagctcaaactg
tggcaatcacagggagagctgtcggcactggatcgccactttgccctgcagatggccgag
cttcacagtgacgattcaccgttgatgctgctgatgtgcgtgttggtgtcacggcagctt
tcccgtcagcatccctgtcttgacttaagcgcattgatgcttggcaacccaatgggcacc
cgtcaggcgcagctgcgcattctggctgattaccctgcactgttgggtgccgttgccaat
ctcgatgccgttggcagcccggatgaaaacaagccactgattttagaaggcaaacgtctc
taccttaagcgctatcaaggctttgagagccgggtcgcggcgcggcttaatgccatggct
ggaactgagctcagtactcatgcccacacggcggcgctgctggaggcgctgttcccggta
ggcaaagaggctatcgactggcaaaaaatcgcggtggccaccgccgcaggaaagcagctg
actgtcatcaccggcggccccggcacgggtaaaaccaccacggtgaccaagttactgctg
ctcttgtcgctgtcatcctcattgaatattcgcatggtggcgcccacgggcaaggccgct
gccagactgtcggagtccatcaaagccagtaagcagcgactgactcaggagttaaactcg
ccccttatctcccaggacgccattgcaagcctgccggaagatgcctcgacccttcaccgt
ctgcttggctttcaacctggcaaccacaaatttcgccatcacagagacaatccgctggat
ttggacttattgctggtggatgaggcctccatggtggatttacccatgatggacaggctg
cttgatgccctgccaggccatgcccggctcattttgctgggcgatcaggatcagctcgct
tcagtggaagccggtgcagtgcttgctgatatttgtgaaggcgcgcgccagggttaccgc
tacagcgcggtacaaaccgcacgcatcgaggggctcacaggcacaaagcttgccccacgc
gcagacgcccccgggcttggcgataacctgtgccgactgctgcatagccacagatttgcc
gaagacgccggtattgggcagctcgccatggcggtaaatgaaggcgacaaagagaaagtc
gctgctgtgtggcaaaaaaactacgcagagctgagctggatcccgggtgataacagtgat
gggctcgcagccttggtgcaactggccaaatccgcctacagcgagtatttacaggcgatg
aaacagcaggccgagcctaaaaccatactgcaaaagtacaatgaatttcgggtactctgc
gccatgaaaaacggcgagtatggcgtggatggtatcaatagggccattaccgcagccctt
gccagagccggactgatagagccaagccaggagttttatgcaggccgcccggtcatgatc
cagagtaacgattacagtctggggctctttaatggcgacattggcatactgcttccggta
gagggggataaccagcgcctgatgacccattttattcaaagcgatggccaggtgcttaaa
gtcctgccggcgagactaccgggacacgagacctgctacgccatgacagtgcacaagagc
cagggcagtgaatttgcctcggtggcactatccttaccgccacagccaaccccatcccaa
cagagcttgattggccgagagctgatttacaccgccattacccgggccaagtcgaagttt
acctgccttgggacagaggctttgtttgaggccgcgacacagcgtcgcaccgagcgggcg
tcggggctggcagaccgcttatggcatgaggattaa

DBGET integrated database retrieval system