KEGG   Shewanella amazonensis: Sama_2360Help
Entry
Sama_2360         CDS       T00445                                 

Definition
(GenBank) Exodeoxyribonuclease VII large subunit
  KO
K03601  exodeoxyribonuclease VII large subunit [EC:3.1.11.6]
Organism
saz  Shewanella amazonensis
Pathway
saz03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:saz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    Sama_2360
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:saz03400]
    Sama_2360
Enzymes [BR:saz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.6  exodeoxyribonuclease VII
     Sama_2360
DNA repair and recombination proteins [BR:saz03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA exonucleases
     Sama_2360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_VII_L tRNA_anti_2 tRNA_anti-codon
Motif
Other DBs
NCBI-ProteinID: ABM00565
UniProt: A1S858
Position
2835793..2837136
Genome map
AA seq 447 aa AA seqDB search
MQVPKNDVYTVSRLNGEVRQLLEGQLGRIWLTGEISNFSSPSSGHWYLTLKDSHSQLRCA
MFKGRNTTVAFKPINGQQVLVRGSISVYEPRGDYQLLIEAMFPAGDGLLAAQFEALKMKL
AAEGLFAQDTKRPLPESIQRIGVITSPTGAAIRDVLHVLKRRDPSVEVVIYPTAVQGTGA
DKDIIRAIELANQRLEVDVLLLTRGGGSLEDLWCFNSEALAHAIYNSTLTIVSAVGHEVD
TSIADFVADVRAPTPSAGAELLSGDQSHKQQKLAGALARLTQGWRHYALKRHSGLISLQS
RLDRQDPKRQLQQQSQRLDELELRLTSSIQRRLSSHTLTTERLKARLERHSPAQRLMMEQ
QRLTYLDERLKGAMEDRLEDAQTHLGGLSHSLASVSPLATLSRGYSITRDAGGRVLTQAS
SMKTGDTIETQLEQGSLLARVIEIKPE
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtccctaaaaatgatgtttataccgtgtcccgcctcaacggcgaagtacggcaa
cttctggagggacagttggggcggatttggctgaccggcgagatctccaatttctcttct
ccttcatccggccactggtacctcaccctcaaagacagccattcgcagctgcgctgtgcc
atgttcaaggggcgtaacaccacagtggcattcaagcccatcaacggccagcaggtgttg
gtgcgtggcagtatcagcgtgtatgaacccagaggcgactatcagctgctgattgaagcc
atgttccccgctggggatggcttgctggcggcccagtttgaagccctgaagatgaaactt
gccgccgaaggtttgtttgcccaggacaccaagcggccgctgcccgagtcaattcagcgc
attggggttatcacctccccaacaggcgcggccatccgcgatgtgctccatgtgctgaaa
agacgtgacccaagcgtggaggtagtaatttaccccacggcagttcagggcaccggcgcc
gacaaagacatcattcgtgccatcgagcttgccaaccagaggcttgaagtggatgtgctc
ctgctcacccggggaggcgggagcctcgaagacctctggtgcttcaacagcgaagccctt
gctcacgccatctacaacagcaccctgaccatagtgagcgcggtgggccatgaggtagat
accagcattgccgactttgtcgccgatgtcagagcaccgacgccttctgcgggcgccgag
ctgctgtcgggagaccaaagccacaagcagcaaaaactcgccggtgcccttgccagactg
acccagggctggcgccattacgcccttaaacgtcattccggtctgatttcactgcaatcc
cggctcgaccggcaagatcctaaacgccagttacagcagcagtcccagcgcctcgatgag
ttggaactgcggctgacatccagtattcagagacgcctatcgtcccacacgcttaccaca
gagcggttaaaggcaaggctcgaacgccactcaccggcccagcgcttgatgatggaacag
cagcggctcacttacctcgatgaaagactcaagggcgccatggaagacaggctggaagat
gcgcaaacacaccttggggggctcagccactcactcgccagcgtgtctccactggcgacc
ttaagccgcggctactccatcacccgagacgctggtggcagggtactgactcaggcgagc
agcatgaaaaccggcgataccatagagactcaactggaacagggttcacttttggcccgc
gtcattgagatcaagccggagtaa

DBGET integrated database retrieval system