KEGG   Shewanella amazonensis: Sama_2426Help
Entry
Sama_2426         CDS       T00445                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
saz  Shewanella amazonensis
Brite
KEGG Orthology (KO) [BR:saz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:saz03009]
    Sama_2426
Enzymes [BR:saz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     Sama_2426
Ribosome biogenesis [BR:saz03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Sama_2426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ Acylphosphatase
Motif
Other DBs
NCBI-ProteinID: ABM00631
UniProt: A1S8C4
Position
complement(2920901..2921986)
Genome map
AA seq 361 aa AA seqDB search
MKNLFLYCRAGYEKDCAAEIQQRAAELGIGGFVKANRDDAYVVFQGFSPDDGDRLAKELP
LDSLIFARQMFACGDLLDDFSPEDRVTPIAESLTEVERAGELRVETPDTNEAKELSAFCR
KFTVPLRQALKKRGVLLDKESSRRPIVHVCFVAPNKAFTGYSLSNNSSPHFMGIPRLKFP
ADAPSRSTLKLDEAFIHFIPREEHETRLRSGLNAVDLGACPGGWTYQLVRRGMMVHAIDN
GPMNHDLMETGQVTHHRADGFKFEPARRNIYWLVCDMVEKPARVAELMEYWAIQGWFKEA
IFNLKLPMKSRYKEVSQILANMHAILKENGIHEFHLACKHLYHDRDEVTVHLWLRPSSPW
I
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacctgttcttatattgccgtgccggttatgaaaaagactgtgcggctgaaatt
cagcagcgggccgccgagctcggcattggtggtttcgtcaaagccaaccgcgacgatgct
tatgtggtatttcagggattcagccctgatgatggtgatcgcctcgccaaagaattgcct
ctggactcgctgatttttgcccggcagatgttcgcctgtggcgatttgcttgatgacttt
tcacctgaagacagggttacccctattgctgagagcctgacggaagttgaacgggcaggg
gaactgcgggtagaaaccccagataccaatgaagccaaagagctttctgccttctgccgt
aaattcacagtgcccctgcgtcaggcattgaaaaagcgtggtgtgctgctggacaaagaa
agcagccgtcgtcccatagtgcatgtgtgctttgtggcgcccaacaaggcttttaccggt
tattcgttgtcaaacaacagctctccacactttatggggatcccgcggctaaaatttccg
gcggacgctccgagtcgttcgacccttaaattggacgaagcctttatccattttattccc
cgtgaagagcacgaaacccgtcttcgcagtggactcaatgcggtggatttgggcgcttgt
cccggtggctggacttatcaattggtgcgccgtggcatgatggtgcacgccatcgataat
ggccccatgaaccatgatctgatggaaaccggacaggtgacgcaccaccgcgctgacggt
ttcaaatttgagccagcccgccgtaatatctactggctggtatgtgacatggtggaaaag
cctgcccgtgtggctgaattgatggaatactgggcgattcagggctggtttaaagaggcg
atttttaacctcaaactaccgatgaaaagccgctacaaagaggtgtcgcagatcctcgcc
aatatgcatgccatccttaaggaaaatggcattcacgagtttcatctggcctgtaagcac
ctttatcacgatcgtgacgaagtgactgtacacctgtggctccgcccaagttcaccttgg
atttga

DBGET integrated database retrieval system