KEGG   Shewanella amazonensis: Sama_2516Help
Entry
Sama_2516         CDS       T00445                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
saz  Shewanella amazonensis
Pathway
saz00330  Arginine and proline metabolism
saz00332  Carbapenem biosynthesis
saz01100  Metabolic pathways
saz01130  Biosynthesis of antibiotics
saz01230  Biosynthesis of amino acids
Module
saz_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:saz00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Sama_2516
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Sama_2516
Enzymes [BR:saz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Sama_2516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ABM00719
UniProt: A1S8L2
Position
complement(3021760..3022899)
Genome map
AA seq 379 aa AA seqDB search
MNSSVQGYRRVVVKLGTSVLTSGSKSLDKAHMVELARQMAGLMKSGVEVVLVTSGAIAAG
REHLGYPVLPDTMANKQLLAAVGQSQLILAWSQLFSIYGLHVGQLLLTRADLHDRERYLN
ARDTLNALLAQGIVPIINENDAVATTEIKVGDNDNLSARAALLCDADLLMLLTDQKGLFD
ADPRKEPNARLIPEVEHIDDSLRLLAGGSVSGLGTGGMATKLQAADIARRAGVEVIIASG
HHPEVIKKAVHREAVGTRFLAIESPLESRKQWILAGPKAKGRLLLDIGAVAAVTCRGRSL
LSKGITGVEGQFERGDTLELVSPDGRVVARGMARYQSQALNLIAGKHSDEIEPLLGYDYG
DAVVHRNDMVVLEMIGEAK
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaactcgagtgtgcagggctaccgacgggtagtggtgaaactggggaccagtgtgctg
acatccggcagcaagtcgttggataaggcacatatggtggagcttgccagacaaatggca
ggactgatgaagtcaggtgtggaagtggtattggtgacctcgggtgccattgccgccgga
cgcgaacacctgggttacccggtattgcccgacaccatggccaacaagcaactcctggcc
gctgtcgggcaaagtcagctcattctcgcctggtcacaactcttcagtatctacggcctg
catgtgggtcagttgctgctgacccgcgctgatctgcacgaccgcgagcgttatctcaat
gcccgcgacaccctcaatgcgctgctggcgcaagggattgtgcccatcatcaacgaaaac
gacgcggtggcgaccactgaaattaaagtaggggacaacgacaacctgtctgcccgcgcg
gcactcctttgcgacgccgatctcctgatgttgctcactgatcagaaaggattattcgat
gctgatccccgcaaagagcccaatgcacgcttgatccccgaggtggagcacatcgacgac
agcctgcgtctgcttgctggcggctctgtctcaggccttggcaccggtggtatggccacc
aagttgcaggcagcggatattgcccgccgcgccggcgtggaagtcatcattgcctcgggt
catcacccggaagtgattaaaaaggcggttcaccgcgaggccgtgggtacccgttttctg
gccattgagagtccactggagagtcgcaaacaatggattttggccggtcccaaggcgaaa
gggcgcctgttgctggacataggtgcggttgccgcagtgacttgccggggccgcagcctg
ttatcgaaaggaattaccggggtcgaaggccagttcgagcgtggagataccctggagctg
gtgagtcccgatggtcgggtggtggcaaggggcatggcacgctaccagtctcaggcattg
aatctgattgccggtaaacactctgatgagattgagccactgcttggttatgactatggc
gatgccgtggtgcatcgcaacgatatggtggtgttggaaatgattggggaggccaagtga

DBGET integrated database retrieval system