KEGG   Shewanella amazonensis: Sama_2756Help
Entry
Sama_2756         CDS       T00445                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
saz  Shewanella amazonensis
Pathway
saz00010  Glycolysis / Gluconeogenesis
saz00030  Pentose phosphate pathway
saz00051  Fructose and mannose metabolism
saz00680  Methane metabolism
saz01100  Metabolic pathways
saz01110  Biosynthesis of secondary metabolites
saz01120  Microbial metabolism in diverse environments
saz01130  Biosynthesis of antibiotics
saz01200  Carbon metabolism
saz01230  Biosynthesis of amino acids
Module
saz_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:saz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sama_2756
   00030 Pentose phosphate pathway
    Sama_2756
   00051 Fructose and mannose metabolism
    Sama_2756
  09102 Energy metabolism
   00680 Methane metabolism
    Sama_2756
Enzymes [BR:saz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Sama_2756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase Amidohydro_2
Motif
Other DBs
NCBI-ProteinID: ABM00959
UniProt: A1S9A2
Position
complement(3295251..3296318)
Genome map
AA seq 355 aa AA seqDB search
MALISLRQLLDHAAEHGYGVPAFNVNNLEQMRAIMQAAEATDSPVIVQASAGARKYARPQ
FLKYLMNAALEQYPDIPVCIHQDHGTHPDVCQRSIQLGMSSVMMDGSLMSDGKTPASYDY
NVDVTRKTVAFAHACGVSVEGEIGCLGSLETGTAGEEDGIGAVGVLSHDQLLTTAEEAAR
FVADTHVDALAIAIGTSHGAYKFSRKPTGDVLRIDRIKEIHARIPNTHLVMHGSSSVPQY
WLEIINQYGGEIPETYGVPLEEIVEGIKHGVRKVNIDTDLRLASTGAVRKFLAENPSEFD
PRKFLKASMEAMADICTERYEAFGCAGMASKIKPLSLQAMYKRYQTGELDPKINL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggcccttatttccctacgtcaactgctggaccacgctgcagagcatggttacggtgtg
cctgcgttcaacgtgaacaaccttgagcagatgcgcgccatcatgcaggcggccgaagcc
accgacagccctgtgattgttcaggcctctgccggtgcccgcaagtacgcccgtcctcag
ttcctcaagtatctgatgaacgccgccctcgagcagtatcctgatatccctgtgtgtatt
caccaggaccacggcacccaccccgacgtgtgccagcgttctatccagctgggtatgagc
tcagtgatgatggacggctctttgatgtccgacggtaaaaccccggcttcttacgattac
aacgtcgacgtgacccgcaagactgtggcattcgcccacgcctgtggtgtgtctgttgaa
ggtgaaatcggctgtctgggtagcctggaaaccggtactgccggtgaagaagatggtatc
ggcgccgttggcgtgctgagccacgaccagctgctgaccaccgccgaagaagccgcgcgc
tttgtggccgacacccacgtggatgccctggccatcgctatcggtaccagccacggcgcc
tacaagttcagccgcaagcctaccggtgacgtgctgcgtattgaccgcatcaaagaaatc
catgcccgtatccccaacacccacctggtaatgcacggctcttcttctgtgccccagtac
tggctggaaatcatcaaccaatacggtggtgaaatccctgagacctacggcgtgccgctg
gaagaaatcgttgaaggcatcaagcacggcgtgcgtaaggtgaacatcgacaccgacctg
cgtctggcctccactggcgcggtacgtaagttcctggccgagaacccaagtgagttcgac
ccacgtaagttcctcaaggcctccatggaagccatggccgatatctgtaccgagcgctac
gaagcctttggctgtgccggtatggcatcgaaaatcaagccgctgtcactgcaggctatg
tacaagcgttatcagaccggcgagctggatcccaagatcaacctctaa

DBGET integrated database retrieval system