KEGG   Sulfurospirillum barnesii: Sulba_0650Help
Entry
Sulba_0650        CDS       T02139                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sba  Sulfurospirillum barnesii
Pathway
sba00860  Porphyrin and chlorophyll metabolism
sba01100  Metabolic pathways
sba01110  Biosynthesis of secondary metabolites
sba01120  Microbial metabolism in diverse environments
Module
sba_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sulba_0650
Enzymes [BR:sba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Sulba_0650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AFL67958
UniProt: I3XVI4
Position
611028..611672
Genome map
AA seq 214 aa AA seqDB search
MGIKSAPIYLFSDQSHEGVEHLPLFEIVFTSSSPRLEEVDAIIFTSKNSVKALELCGVYW
QDKACYAIGEGTAAAIRACGGNLLFTCKHSYGDLFAHELIPLLKDKRVFFPRAKEVISPL
FEILHSAGVTIFQEIMYETLCRHYAPVYAPAKNAILIFTSPSTVHCFLKNFSWDESYRTI
VIGTKTAAVLPLHVKPIIAEVQTIAHCVALAKAL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgggaataaaatctgctcctatctacctctttagcgaccaatcgcatgaaggggtagag
catttgcctctatttgaaatcgtttttacctcctcatcccctaggcttgaagaggttgat
gcgattatttttacctccaaaaatagtgtcaaagcacttgaactgtgtggcgtatattgg
caagataaagcgtgttatgccataggggagggaacagctgctgccatacgtgcctgcggc
ggcaatcttctctttacatgtaaacactcctatggtgatctttttgcgcacgaactgatt
cctttattgaaagataaacgtgtttttttcccacgtgccaaagaggttatttcgccttta
tttgaaattttacactcagcaggtgtcactatttttcaagaaattatgtatgaaacactc
tgtagacactatgcccctgtttatgcacctgctaaaaatgctattcttatcttcacatct
ccctcaacagtccattgctttttaaagaatttttcatgggatgagagttatcgtactatc
gtgattggtacaaaaacagcagcggttttacccttacatgtaaaacctatcattgccgaa
gtgcaaacgatagcgcattgcgttgcattggcaaaagctctttag

DBGET integrated database retrieval system