KEGG   Sulfurospirillum barnesii: Sulba_1319Help
Entry
Sulba_1319        CDS       T02139                                 

Definition
(GenBank) polyprenyl p-hydroxybenzoate/phenylacrylic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
sba  Sulfurospirillum barnesii
Pathway
sba00130  Ubiquinone and other terpenoid-quinone biosynthesis
sba00627  Aminobenzoate degradation
sba01100  Metabolic pathways
sba01110  Biosynthesis of secondary metabolites
sba01120  Microbial metabolism in diverse environments
sba01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sba00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Sulba_1319
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Sulba_1319
Enzymes [BR:sba01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     Sulba_1319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AFL68611
UniProt: I3XXD7
Position
complement(1281268..1281795)
Genome map
AA seq 175 aa AA seqDB search
MKRIVIGISGASGVELGLKFVQALPLEIEKYLIISDHAKIVFNKESNTILLDDNNIGAIT
ASGSFKTDAMVIIPCSMNTLAKITHGIADNLLTRTAAVMLKERRPLLLAPREMPFSSIAL
ENMLKLSMLGVHIAPPVLGYYAQNDTLDAMENFLIGKWFDLLGIEHTLFKRWEGA
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatagttataggaattagtggtgcaagtggggttgaattaggtttaaaattt
gttcaagcactccccttagagattgaaaaataccttattatttcagaccatgcaaagatc
gttttcaataaagaatccaatacgattttacttgatgataacaacattggtgccattaca
gcctcaggttcctttaaaacagatgctatggtgattattccttgcagtatgaacacttta
gctaaaattacgcatggtattgcggataatttactcacacgcaccgcagcagtaatgctt
aaagaaaggcgccctcttctacttgctcctcgtgaaatgcctttttcttccattgcctta
gaaaatatgctcaaactctctatgctaggggtgcatatcgcaccacctgttttgggatat
tatgcacaaaatgatacactcgatgctatggagaattttttaattggaaaatggtttgat
cttttagggattgaacacacgttgtttaaacgatgggagggtgcatga

DBGET integrated database retrieval system