KEGG   Auricoccus indicus: BVH56_00330Help
Entry
BVH56_00330       CDS       T04690                                 

Definition
(GenBank) malate dehydrogenase (quinone)
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
sbac  Auricoccus indicus
Pathway
sbac00020  Citrate cycle (TCA cycle)
sbac00620  Pyruvate metabolism
sbac01100  Metabolic pathways
sbac01110  Biosynthesis of secondary metabolites
sbac01120  Microbial metabolism in diverse environments
sbac01130  Biosynthesis of antibiotics
sbac01200  Carbon metabolism
Module
sbac_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbac_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sbac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BVH56_00330
   00620 Pyruvate metabolism
    BVH56_00330
Enzymes [BR:sbac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     BVH56_00330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3 K_oxygenase Pyr_redox_2 Pyr_redox HI0933_like
Motif
Other DBs
NCBI-ProteinID: AQL55500
UniProt: A0A1Q1FZI0
Position
59379..60851
Genome map
AA seq 490 aa AA seqDB search
MNKTDVILIGGGIMSATLGTLLKKLDPTLSIRVFEKLDGPAQESSNVWNNAGTGHSALCE
LNYTKEQPNGVIDIKKAINVNEQFQVSKQFWSYLVKEGKLQDPSRFIMPVPHMSFVLGKE
NVEFLKKRVEMLNGNVLFEGMEFSDSKSELSEWAPLMMEGRTSDEPIAMSKMDAGTDVNF
GQLTKDLFEDLEAQGVEIHYSHEVKNFKEVEDGSWQLEVQDHQFGKTDYYNADFVFIGAG
GHALPLLQKTGIKQSKHVGGFPVSGVFLTCSEESIAEQHLAKVYGKAEVGAPPMSVPHLD
TRYIDGKRTLLFGPFAGFSPKFLKSGSYLDLIQSVKPYNVTTMLASGAKEMPLTKYLIGQ
LMLSHEDRMEDLRKFVPTAKDEDWSTTIAGQRVQVIKDTETGGKGTLQFGTEVVTSDNGS
IAALLGASPGASTAVSVMIDLLGKCFPERMDEWDAKLKEMIPSYGQLLTDNPDLFKEINK
DTAKTLGLNE
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaataagacagatgtcatattaattggtgggggcattatgagtgcaacgcttggaacg
ctcctaaagaaattagacccaacactttcaattagagtgttcgagaaattagatggaccg
gctcaagagtcatcgaatgtgtggaacaacgctggaacaggacattcagcattgtgtgaa
ttgaactatacgaaagaacagccgaatggtgtcattgatattaagaaagcgatcaatgtc
aatgagcaattccaagtgtctaaacaattttggagctatttagtgaaagaagggaagtta
caagacccttcacgatttattatgccggtaccacatatgagcttcgttcttggtaaagag
aatgtcgagttcttaaagaaacgtgtagaaatgttaaatgggaatgttttattcgaaggc
atggaattcagtgatagtaaatctgagctgagtgagtgggcacctctcatgatggaaggt
cgtacatcggatgagccaattgcaatgagtaagatggatgctggaacagatgtgaatttc
ggtcaattgacgaaagatttattcgaagatcttgaggcacaaggcgttgaaattcattat
tcacatgaagtgaagaactttaaagaagtagaagacggtagttggcaactagaagtccaa
gatcatcaatttggtaagacagactattacaatgcggactttgtatttataggagcaggt
ggtcatgcattaccgttattacagaaaacaggtattaagcaatcgaaacatgttggagga
ttcccagtgagtggtgtgttcttaacgtgttcagaagaatcgattgcagagcaacattta
gcgaaagtttacggtaaagccgaagtcggtgcaccaccaatgagtgtaccacatttagat
acacgctatattgatggaaagagaacattattgttcggcccattcgcaggattctcaccg
aaattcttaaaaagtggatcgtaccttgatttgattcaatcagtgaaaccatataatgtg
acgacgatgctcgcatctggtgcgaaagaaatgccactgacgaaatacttaatcggtcaa
ttaatgttatcgcatgaagatcgaatggaagacttacgtaaatttgtaccaacagcgaag
gatgaagattggtcaacgaccatcgcaggtcaacgtgtacaagtcattaaagatacagaa
acaggcggtaaagggacacttcaattcggaacagaagtcgtcacaagtgacaacggttca
atcgccgcattactcggcgcaagcccaggcgcaagtacagctgtttctgtgatgattgat
ttactaggaaagtgcttcccagaacgtatggatgaatgggacgctaaattaaaagaaatg
attccaagttatggccaattattaacggataaccctgacttgtttaaagaaatcaataaa
gacacagcaaaaacgctcggattaaatgaatag

DBGET integrated database retrieval system