KEGG   Auricoccus indicus: BVH56_01815Help
Entry
BVH56_01815       CDS       T04690                                 

Definition
(GenBank) fructose bisphosphate aldolase
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
sbac  Auricoccus indicus
Pathway
sbac00010  Glycolysis / Gluconeogenesis
sbac00030  Pentose phosphate pathway
sbac00051  Fructose and mannose metabolism
sbac00680  Methane metabolism
sbac01100  Metabolic pathways
sbac01110  Biosynthesis of secondary metabolites
sbac01120  Microbial metabolism in diverse environments
sbac01130  Biosynthesis of antibiotics
sbac01200  Carbon metabolism
sbac01230  Biosynthesis of amino acids
Module
sbac_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sbac_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sbac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BVH56_01815
   00030 Pentose phosphate pathway
    BVH56_01815
   00051 Fructose and mannose metabolism
    BVH56_01815
  09102 Energy metabolism
   00680 Methane metabolism
    BVH56_01815
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sbac04131]
    BVH56_01815
   03036 Chromosome and associated proteins [BR:sbac03036]
    BVH56_01815
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbac04147]
    BVH56_01815
Enzymes [BR:sbac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     BVH56_01815
Membrane trafficking [BR:sbac04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BVH56_01815
Chromosome and associated proteins [BR:sbac03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    BVH56_01815
Exosome [BR:sbac04147]
 Exosomal proteins
  Proteins found in most exosomes
   BVH56_01815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycolytic Clp_N
Motif
Other DBs
NCBI-ProteinID: AQL55765
UniProt: A0A1Q1G096
Position
complement(325016..325906)
Genome map
AA seq 296 aa AA seqDB search
MHKEHLEIAKNGKGFIAALDQSGGSTPKALKSYGVDESEYSNEQEMFDLVHEMRSRIITS
PAFTSDKVVGAILFERTMDSKIDGKYTADYLSDIGVVPYLKVDKGLADLENGVQLMKPMP
ELDTLLDRAIERNIFGTKMRSNIMELNEEGIKEVVKQQFEIGKQIIAKGLVPIIEPEVNI
DAKDKEQIEEVLKNEILKELDQLSEDQPVMLKLTIPTKPNAYKELVDHPRVIRVVALSGG
YSREDANEKLAQNEGVIASFSRALINDLRKSQSDEEFNKNLQDTIDSIYDASVNKK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcataaagaacacttagaaatcgcaaaaaatggtaaaggatttatcgctgcattagac
caatcaggtggttcaacacctaaagcattgaaatcttatggtgtagacgaaagtgaatac
tcaaatgaacaagaaatgttcgatttagttcacgaaatgcgttcacgtattattacatca
ccagcattcacttcagataaagtcgttggtgctattcttttcgaacgtactatggattca
aaaatcgacggtaaatacactgctgattatttatcagatattggtgttgtaccgtactta
aaagtagacaaagggttagctgatcttgaaaatggtgttcaactgatgaaacctatgcct
gaattagatacattattagaccgtgctattgagcgtaacatctttggtactaaaatgcgt
tctaacattatggaattaaatgaagaaggtattaaagaagttgttaagcaacaatttgaa
attggtaaacaaatcattgctaaaggtttagttccaattatcgaaccagaagtaaatatc
gacgcaaaagataaagaacaaattgaagaagtacttaaaaatgaaatcttaaaagaatta
gatcaattatcagaagatcaaccagtaatgttaaaattaacgattcctactaaacctaac
gcatacaaagagttagtagatcacccacgtgtaattcgtgtagttgctttatctggtgga
tactctagagaagatgctaatgaaaaacttgctcaaaacgaaggtgtcattgcaagcttc
tcacgtgcattaatcaatgatttacgtaaatctcaatctgatgaagaatttaacaaaaac
ttacaagatacaatcgattctatctacgatgcatctgtaaataaaaaataa

DBGET integrated database retrieval system