KEGG   Auricoccus indicus: BVH56_01850Help
Entry
BVH56_01850       CDS       T04690                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
sbac  Auricoccus indicus
Pathway
sbac00520  Amino sugar and nucleotide sugar metabolism
sbac01100  Metabolic pathways
sbac01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sbac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BVH56_01850
Enzymes [BR:sbac01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     BVH56_01850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AQL55772
UniProt: A0A1Q1G0A0
Position
complement(331743..332885)
Genome map
AA seq 380 aa AA seqDB search
MIIAGGTICSENRQIKNGAIEIVGKKIKEIYNNVNDLVVDLHIDDDALIIPGAIDTHIHG
ANSFDTMDATIESLEGLSNYLPSTGTTSFMPTTMTTDISSVNNALNTVYQYQEKVSGACI
IGVHLEGPFISPVYPGAQDPKHIMKPTHNHLYSLVSKYPGLIKQITFAPEEVEDTSFYQL
INDNGIVPSFGHTNATADQLKNTRINKATHLYNAMRPLHHRELGVVGYSLMNDDIDVELI
VDGIHITEDVVHFTYKSKSSERIILITDSMRAAGLSDGNYDLGGQPVYVKDQKATLQDGT
IAGSTLTMNQALKNMHRYTQSDINALIEMSATNPAKLFNLYDRKGSITVGKDADLVIYDQ
NFNVLYTFVEGKLVYTSKEI
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgataattgcgggtggaacaatttgttcagagaatcgtcaaattaaaaatggtgccatt
gagatagtgggtaaaaaaattaaagaaatttacaacaacgttaatgatttagtggtggat
ctgcatatcgatgatgatgcactcattattcctggggcgattgatacacatattcacggc
gcaaattcctttgatacgatggatgctacaattgaaagcttagaaggattatcaaattat
ttaccaagcacaggtacgacttcatttatgccgacaacaatgactactgacatatcttca
gtcaataatgcattgaatactgtgtatcaatatcaagaaaaagtatctggcgcgtgtatt
atcggtgtccatcttgaaggaccattcatttcaccggtctatcccggtgcccaagatcca
aagcatataatgaaaccaacacataatcatttgtattcattggtttcaaagtatcctggc
ttaattaaacaaataacgttcgcacctgaagaagttgaggatacttctttttatcaatta
ataaatgacaatggaattgtcccatcatttggtcatacgaacgccacagcagatcagtta
aagaatacacgtattaataaagcgacacatctgtacaatgcaatgcgtccgcttcatcat
cgtgaacttggtgtcgttggttatagcttaatgaatgatgacattgatgttgaactcatt
gtcgatgggattcacatcaccgaagacgttgttcactttacatataaaagtaaatcaagt
gaacgtatcatattgattaccgatagtatgcgcgcagctggtctatccgatggcaattat
gacttaggaggacaaccagtgtatgttaaagatcagaaagctacacttcaagatggaaca
atcgctggaagtactttaacgatgaatcaagcattaaaaaatatgcatcgatatactcaa
agtgatatcaatgcattaatagaaatgtcagcaacaaatcctgctaaactatttaattta
tatgatcgtaaaggaagtattactgtcggaaaagatgccgacttagttatctatgatcaa
aactttaatgtgttatacacatttgttgaaggtaaattagtctatacaagtaaggagatt
tga

DBGET integrated database retrieval system