KEGG   Auricoccus indicus: BVH56_04325Help
Entry
BVH56_04325       CDS       T04690                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
sbac  Auricoccus indicus
Pathway
sbac00670  One carbon pool by folate
sbac00790  Folate biosynthesis
sbac01100  Metabolic pathways
Module
sbac_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sbac00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BVH56_04325
   00670 One carbon pool by folate
    BVH56_04325
Enzymes [BR:sbac01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BVH56_04325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AQL56194
UniProt: A0A1Q1G1H8
Position
805916..806419
Genome map
AA seq 167 aa AA seqDB search
MLKLIVAHDLNNVIGWKGNMPWHISNDLKRVKQITTGETIVMGRGTFESLGKPLPNRTNV
VLTSDKTFNNDHQFDIEVIHSIEDLNNYNSPIIFGGGNLYQQVIDQIDEMYITLVHEKFI
GDTFFPEYNLEDFEIISSEKFNINKNKALTYEFLHLKKIKGRKNNKE
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaattaattgttgctcatgatttaaacaatgttattggttggaaaggaaatatg
ccatggcatatttctaatgatttaaaaagagttaaacaaataacaactggtgaaacgatt
gttatgggaagaggaacatttgaatctctaggaaaaccgttaccaaatagaactaacgtt
gtcctaacttcagataaaacatttaataatgatcatcaatttgatattgaagtaattcat
agcatagaagatttgaataattacaattcgccgattatatttggtggaggtaacttatat
cagcaagtaatagatcaaattgatgaaatgtatatcacactcgtacacgaaaaatttatt
ggtgacactttttttccagaatataacttagaagattttgaaatcatttcatcagaaaaa
tttaatataaataagaataaggcgttgacttatgagtttttacatttaaagaagattaaa
ggaagaaaaaataataaagaataa

DBGET integrated database retrieval system