KEGG   Auricoccus indicus: BVH56_05260Help
Entry
BVH56_05260       CDS       T04690                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
sbac  Auricoccus indicus
Brite
KEGG Orthology (KO) [BR:sbac00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sbac03009]
    BVH56_05260
Enzymes [BR:sbac01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     BVH56_05260
Ribosome biogenesis [BR:sbac03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BVH56_05260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: AQL56366
UniProt: A0A1Q1G1X6
Position
complement(1019088..1019996)
Genome map
AA seq 302 aa AA seqDB search
MQQQFEFHIEEESGRIDKYLTEQNSDWSRSQIQDWIKLGLVTVNDKPIKPNYQVSNGDYI
VVTEKEQQKIDLTPENLNLNIVYEDDDVAVVCKPKGMVVHPAPGHPTKTLVHGLLYQLKN
LSGINGEIRPGIVHRIDMDTSGLLMVAKNDIAHRALVEQLVDKSVTRVYTALVHGVIPHN
NGTIEAPIGRNPKERQEMAIVDDGKEATTHFNVLKRYENYTLVECILETGRTHQIRVHMK
YIGYPLVGDPKYGPKKTMDTDGQMLHAGVIGFNHPTKNEYMEFESPLPDAFESVLKKLRP
MT
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaacaatttgaatttcatatcgaagaagaatctggccgtattgataaatatttg
acagagcaaaatagtgactggtcaaggtctcaaatccaagattggattaagcttggctta
gtgactgtgaatgacaaaccaattaaaccgaattatcaagtcagtaacggtgattatatt
gtagtcactgaaaaagaacagcaaaaaattgatttaacccctgaaaatttaaatttaaat
attgtttatgaagatgatgatgtggctgtagtttgcaagccgaaaggcatggttgttcat
cctgcaccaggacatccaacgaagacattagtccatgggttattatatcaattgaaaaat
ttatcggggattaatggtgaaataagacctggtattgttcatcgaattgatatggatact
tctggactattgatggttgctaaaaatgatattgcacatagagcattagttgaacaactt
gtagacaaatcagtgactcgggtctatacggcacttgttcacggtgtgatacctcacaat
aatggaacgattgaagcacctattggtcgtaatccgaaagagcgacaagaaatggcgatt
gtcgatgatggtaaagaagcgacgacacattttaatgttttaaagcgctatgaaaattac
acactcgttgaatgtatattagaaacgggtagaacacatcaaattcgtgttcatatgaag
tatattggatatccacttgtcggagatcctaaatacggaccaaagaagacgatggatacg
gatggccaaatgttacatgcaggagtaattggctttaatcatccgacaaagaatgaatat
atggaatttgaatcaccactaccagatgcattcgaatccgtacttaaaaaattacgtcca
atgacttga

DBGET integrated database retrieval system