KEGG   Candidatus Saccharibacteria bacterium GW2011_GWC2_44_17: UW38_C0001G0718Help
Entry
UW38_C0001G0718   CDS       T04605                                 

Gene name
manC
Definition
(GenBank) Mannose-1-phosphate guanylyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
sbag  Candidatus Saccharibacteria bacterium GW2011_GWC2_44_17
Pathway
sbag00051  Fructose and mannose metabolism
sbag00520  Amino sugar and nucleotide sugar metabolism
sbag01100  Metabolic pathways
sbag01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    UW38_C0001G0718 (manC)
   00520 Amino sugar and nucleotide sugar metabolism
    UW38_C0001G0718 (manC)
Enzymes [BR:sbag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     UW38_C0001G0718 (manC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 MannoseP_isomer
Motif
Other DBs
NCBI-ProteinID: AKM80562
UniProt: A0A0G4B0P6
Position
complement(637732..638781)
Genome map
AA seq 349 aa AA seqDB search
MITVIIAGGSGTRLWPLSTPKYPKHLLSLTGEKSILQMTYERAKHLGDSVYVVTEASHSD
HVKEQLPELTDEAFIIEPGRRGTAHCIVMSLDYIARRHDHAEQIAFISADHSIRDTAGFT
RSFNLAAKVSADKNEIALIGIEPTFAATGFGYIERDGVIDADAGVYNVESFKEKPDFETA
KTYVASGNYLWNCGYFVGSVDTFLHEMSQSAPELERSYEVLANIDDLTSYEYRDAYLELD
NQVIDIALIEKAQSLAVVSANFDWMDVGNFKDLHEANQSDEDNNYFRGENIHGLEVENVF
IRNEDPAKHVAVIGLDNIVVVNTPEGLLVARKDLSPRVGEIAKKIQAAQ
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgattacagttattatcgccggtgggtcggggacgcgtttatggccactctcaacgcct
aaataccctaagcatctattgagtttaactggagagaaatctattcttcagatgacttac
gagcgtgcgaaacatttgggtgattccgtctatgtcgttactgaggcgagccactctgat
catgtaaaggaacagttaccagaacttacggatgaagcatttatcattgaaccgggacgg
cgtggaactgcacactgtattgtgatgtcgcttgattacattgctcgccgtcacgaccac
gcagagcagattgcatttatatctgccgatcatagtattcgtgatacagctggttttacg
cgatcatttaacctggctgctaaggtttcggccgataaaaatgagatagcacttatcggg
attgaaccaacatttgctgcaacgggatttggctatattgagcgtgatggggtgatcgat
gcggatgcaggagtttataatgttgaatcatttaaggagaagcctgactttgagacagca
aaaacatatgttgcatcaggaaattacctatggaactgcggttactttgtagggtcggtt
gatacattcttgcatgagatgagtcagagtgctccggagcttgagaggagctacgaggtg
ctagcgaacattgatgatctaacatcatatgagtatcgagatgcttatcttgagctggac
aatcaagtaattgacattgctcttatcgaaaaagcccaaagccttgcggttgtatctgca
aactttgactggatggatgttggtaattttaaagatttacatgaagctaatcaatccgat
gaagataataattattttcgaggtgaaaatattcatggtctagaagtggagaacgttttt
atcagaaacgaagatcctgcaaaacatgtagctgtcatcggcttagataacattgttgtc
gtcaataccccagagggcttactcgtagctcgtaaagatttgagtccacgagtgggtgag
atagctaaaaagatacaggctgcacaataa

DBGET integrated database retrieval system