KEGG   Shewanella baltica BA175: Sbal175_1592Help
Entry
Sbal175_1592      CDS       T02014                                 

Definition
(GenBank) Fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sbb  Shewanella baltica BA175
Pathway
sbb00071  Fatty acid degradation
sbb00280  Valine, leucine and isoleucine degradation
sbb00281  Geraniol degradation
sbb00310  Lysine degradation
sbb00362  Benzoate degradation
sbb00380  Tryptophan metabolism
sbb00410  beta-Alanine metabolism
sbb00640  Propanoate metabolism
sbb00650  Butanoate metabolism
sbb00903  Limonene and pinene degradation
sbb00930  Caprolactam degradation
sbb01040  Biosynthesis of unsaturated fatty acids
sbb01100  Metabolic pathways
sbb01110  Biosynthesis of secondary metabolites
sbb01120  Microbial metabolism in diverse environments
sbb01130  Biosynthesis of antibiotics
sbb01200  Carbon metabolism
sbb01212  Fatty acid metabolism
Module
sbb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Sbal175_1592
   00650 Butanoate metabolism
    Sbal175_1592
  Lipid metabolism
   00071 Fatty acid degradation
    Sbal175_1592
   01040 Biosynthesis of unsaturated fatty acids
    Sbal175_1592
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sbal175_1592
   00310 Lysine degradation
    Sbal175_1592
   00380 Tryptophan metabolism
    Sbal175_1592
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sbal175_1592
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Sbal175_1592
   00281 Geraniol degradation
    Sbal175_1592
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sbal175_1592
   00930 Caprolactam degradation
    Sbal175_1592
Enzymes [BR:sbb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Sbal175_1592
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Sbal175_1592
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Sbal175_1592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 LEM Gemin6
Motif
Other DBs
NCBI-ProteinID: AEG10868
UniProt: G0AU38
Position
1881897..1884017
Genome map
AA seq 706 aa AA seqDB search
MEKTFNLTRRDDGIAILTMDVPGETMNTLKAQFGPEISEILAEIKSDSSIRGLVLISGKK
DSFVAGADISMLDACETAGDAKALSQQGHVVFNELEALKIPVVAAIHGACLGGGLELALA
CHQRVCSDDGKTMLGVPEVQLGLLPGGGGTQRLPRLVGITTALDMMLTGKQIRPKQALKM
GLVNDVVPQTILLQTAVEMALAGKRAPKPVKKSLVNQVLEGTSFGRNIIFDQATKQVEKK
TQGNYPAPAKIIDCVRQGIAKGMQKGLEVEASHFAELVVSKESEALRSIFFATTEMKKET
GAEGASPRKVKKAVILGGGLMGGGIASVTTTKAKIPVRVKDISEKGLSNALAYAYKLLDK
GVKRRHMTPAARDNLMALMTTTTEYKGVKDADIVVEAVFEDLALKHQMVKDIERECGEHT
IFASNTSSLPISQIAEAATRPENVIGLHYFSPVEKMPLVEVIAHAKTSPETIATTVAFAR
KQGKTPIVVQDGAGFYVNRILALYMNEAAQLLLEGQSVEHLDKALVKFGFPVGPITLLDE
VGIDVGAKISPILEKELGERFKAPAAFDKLLGDDRKGRKNGKGFYQYGASSKKAKAVDES
VYGVLGIKPGTNKDAKAVAERCVVQMLNEAVRCLEDGIIASPRDGDIGAIFGIGFPPFLG
GPFHYIDTLGAANLVRILEGYQSQLGSRFEPCERLKTMAQENAHFF
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagacctttaatttaacccgccgcgacgacggcattgccatcttgactatggat
gttcctggtgaaaccatgaacaccctaaaagcgcagtttggccctgaaatcagtgaaatt
ttggccgagataaaaagtgattcgagcattcgcggtttagtgctgatctcaggcaaaaaa
gattcttttgttgcgggcgcagatatttctatgctcgatgcctgtgaaacggctggcgat
gccaaagccttatcccagcaaggccatgtggtttttaatgagttagaagccttaaaaatt
cctgtggttgcggcaatccacggtgcctgtttaggtggtggtttagagttagccttagcc
tgtcatcaaagggtatgtagcgacgatggcaagactatgctcggcgttccggaagtccaa
cttggcttattgccaggcggcggcgggactcaacgtttgccacgtttagtcggcattacg
accgccttagatatgatgttgaccggtaaacaaattcgtcctaaacaagccttgaaaatg
ggcttagtgaatgatgttgtgccgcagacgattctgttacaaaccgccgttgagatggcg
cttgcgggtaaacgtgcaccgaaaccagttaaaaaatcactcgttaatcaagtgcttgaa
ggcacgagtttcggccgtaacattattttcgatcaagcgacaaaacaggtcgaaaagaaa
acccaaggtaattatcctgcgcctgccaagatcattgactgcgtgcgtcaagggattgct
aagggcatgcaaaaagggctcgaagtcgaagccagtcattttgccgaattagtggtatcg
aaagagtctgaagcgctgcgcagtattttcttcgcaaccacagaaatgaagaaagaaact
ggcgcagaaggcgcgagcccgcgcaaagtgaaaaaagcggtgatcttaggtggcggttta
atggggggcggtatcgcatctgtcacaacgaccaaggctaaaatccctgttcgtgtcaaa
gacatcagcgaaaaaggtttaagcaatgcattagcttatgcctacaagctgttggataaa
ggggttaagcgccgtcatatgacgcctgctgcccgtgacaacttaatggcactgatgacc
acaacgactgaatataaaggcgttaaagatgccgacatcgttgtggaagcggtatttgaa
gacttagcgcttaagcatcaaatggtgaaagacattgagcgtgagtgtggtgagcacact
atttttgcgtcaaacacctcatctttgcctattagccaaatcgccgaagcggcaacgcgt
cctgagaacgtgataggtctgcattatttctcgccagtagaaaaaatgccgctggtggaa
gtgattgcccatgctaaaacgtcgccagaaaccattgcgaccacggtcgcatttgcccgt
aagcaaggtaaaacaccgatagtggtacaagacggcgcgggtttctacgtgaaccgtatt
cttgcgctgtacatgaatgaggccgcgcaattattacttgaaggccaaagtgttgaacat
cttgataaagcgctggttaagtttggtttccctgtgggccccattactttactcgacgaa
gtgggtatcgacgtgggcgctaagatttcaccaatcctcgaaaaagaattgggtgaacgt
tttaaagcgccagcggcttttgacaagcttttgggtgacgatcgtaaaggccgtaaaaat
ggcaaaggtttctatcaatacggcgcatcgagcaagaaagccaaagctgtcgatgagagt
gtttatggcgtgttaggcattaaacctggcaccaataaagacgcaaaagcggttgccgag
cgttgtgtcgtacaaatgctcaacgaagcggtgcgttgtttagaagacggtattatcgca
tcgccaagagatggtgatattggcgccattttcggtattggcttcccgccattcctcggt
ggtccattccactatattgacactttgggtgctgcgaacttagtgcgaattcttgaaggt
tatcaaagccaattgggtagcagattcgaaccttgtgagcgcttaaaaaccatggctcaa
gaaaacgcgcactttttctaa

DBGET integrated database retrieval system