KEGG   Shewanella baltica BA175: Sbal175_1913Help
Entry
Sbal175_1913      CDS       T02014                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sbb  Shewanella baltica BA175
Pathway
sbb00450  Selenocompound metabolism
sbb00970  Aminoacyl-tRNA biosynthesis
sbb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Sbal175_1913
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Sbal175_1913
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sbb01007]
    Sbal175_1913
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sbb03016]
    Sbal175_1913
Enzymes [BR:sbb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Sbal175_1913
Amino acid related enzymes [BR:sbb01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Sbal175_1913
Transfer RNA biogenesis [BR:sbb03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Sbal175_1913
 Prokaryotic type
   Other AARSs
    Sbal175_1913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AEG11183
UniProt: G0AXF6
Position
complement(2261808..2263877)
Genome map
AA seq 689 aa AA seqDB search
MATSQRKILVTSALPYANGPIHLGHMLEYIQTDIWSRYQKLRGHECHYICADDAHGTPIM
LKAQQLGIAPEDMIAQVNKEHQQDFADFNVAFDNYHSTHSEENRLMASDIYLKLRDNGYI
KSKSISQLFDPEKSMFLPDRFVKGTCPKCKSPDQYGDNCDSCGATYSPTELINPKSAVSG
ATPVMKDTEHFFFDLPAFEGMLKEWTRSGALQVEMANKLDEWFEQGLQQWDITRDAPYFG
FEIPDAPGKYFYVWLDAPIGYMGSFKNLCAKRPELSFDEFWGKDSTAEVYHFIGKDIVYF
HSLFWPAMLHGSGYRQPNSVYAHGYVTVNGAKMSKSKGTFIKARTYLDHLDPEYLRYYYA
AKLSSRIDDLDLNLEDFAQRVNSDLVGKLVNLASRTAGFITKRFDGKLAKIADTTLTEAF
LAKQDVIADFYESREYGKAMREIMALADIANGFVADAAPWQMVKHDDQQEAAHQVCSNAL
NLFRILVTYLKPVLPRLAQDVEAFFQLPLTWDALSQDLAGHEIAPFKAMMQRVELDKVNA
MVADSKDNLQVTADAPKTAPVEKAVEASAVSNKPLVDDPISETINFDDFAKIDLRIARII
KAEHVADADKLLKLQLDIGGETRQVFAGIKSAYSPEDLEGKLTVMVANLAPRKMRFGMSE
GMVLAAGPGGSDLWILEPHEGAQPGMRVK
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggcaacttcacaacgtaaaattctcgtgaccagcgcacttccctacgcaaacggaccg
atacatttaggtcacatgttggaatacatccagacagatatctggtcgcgttatcaaaaa
cttcgtggacatgagtgccactatatttgtgccgatgacgcccatggcacgccgatcatg
cttaaagcgcagcaattaggcatagcgcctgaagatatgatcgcccaagtgaacaaagaa
catcagcaggattttgccgattttaatgtcgccttcgataactatcacagcactcacagc
gaagaaaaccgcctcatggcgagcgatatttatctcaagctacgggacaacggctatatc
aagagcaagagcatttctcagttattcgatcctgaaaaatccatgttcctgcccgaccgc
ttcgtaaaaggcacttgccctaaatgtaagtcacctgatcaatatggcgataactgtgat
tcttgcggcgcgacttacagcccaactgaactgatcaatccaaaatcagcggtatcgggt
gcaacgccagtgatgaaagacactgagcactttttcttcgacctgcccgccttcgaaggc
atgctaaaagagtggactcgctctggcgctctgcaagtcgaaatggccaataaactcgat
gaatggtttgagcaaggtctgcagcaatgggacatcacccgtgatgcaccgtattttggt
ttcgaaattcccgatgcaccgggcaagtatttctatgtgtggttagatgcgcctatcggc
tacatgggttcattcaaaaacctgtgtgcaaaacgtcctgagctgagcttcgatgaattc
tggggcaaagattctactgctgaggtttatcacttcatcggtaaagacatcgtttacttc
catagcctcttctggccagccatgctgcacggctcaggttatcgtcagccaaacagcgtc
tatgcccacggttatgtgacggtcaacggcgcgaagatgtctaaatcgaaaggcaccttc
attaaggcacgtacctatttagatcatttagatcctgaatatttacgttactactacgcc
gccaaactcagcagccgtatcgacgatttagatttaaatctggaagatttcgcccagcgc
gtgaactcagatttagtcggtaagctagtgaacttagcctcgcgcaccgcaggttttatc
actaaacgctttgatggcaagctcgcgaaaattgctgatactacgctgaccgaagcgttt
ttagccaagcaagacgtgattgccgatttttacgagtcgcgcgaatacggcaaagcgatg
cgcgaaatcatggcgctggcggatattgccaacgggtttgtggctgatgctgcaccttgg
caaatggtgaaacatgacgatcaacaggaagctgcccatcaagtgtgttcaaacgccttg
aatctgttccgtattctcgtgacgtatctaaaacctgtattgccacgtttagcccaagat
gtggaagccttcttccaattgccactcacttgggatgcattgagccaagatttagcgggt
catgaaatcgccccattcaaggcaatgatgcaacgtgttgagctagataaagtcaatgct
atggttgctgattccaaggataacctgcaagtcacggccgatgcaccaaagacggctccc
gttgaaaaagcggttgaagcttcggcggttagcaataaaccgctggttgacgatccgatc
agtgaaaccatcaactttgatgattttgcgaaaatcgacctacgtatcgctcgcatcatc
aaagccgagcatgttgctgacgctgacaagttactcaagttacaactcgacatcggtggt
gaaacgcgccaagtgtttgctgggatcaaatcggcttattcgccagaagatctcgaaggc
aagttaactgtaatggtggcgaacttagcgccacgtaagatgcgttttggcatgtcagaa
ggtatggtgttagctgcaggccctggtggcagcgacctgtggattttagaaccccatgaa
ggcgcacagcctggcatgcgtgttaagtaa

DBGET integrated database retrieval system