KEGG   Shewanella baltica BA175: Sbal175_2049Help
Entry
Sbal175_2049      CDS       T02014                                 

Definition
(GenBank) type VI secretion-associated protein, ImpA family
  KO
K11902  type VI secretion system protein ImpA
Organism
sbb  Shewanella baltica BA175
Brite
KEGG Orthology (KO) [BR:sbb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sbb02044]
    Sbal175_2049
Secretion system [BR:sbb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Sbal175_2049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImpA_N T6SS_VasJ Spore_III_AB DUF1953
Motif
Other DBs
NCBI-ProteinID: AEG11317
UniProt: G0AY91
Position
2424951..2426042
Genome map
AA seq 363 aa AA seqDB search
MDYDDIIDFSLLIKNVNELAPSGVDPRTDISPSSQYYRLKDIRSNARANERKLLVEEDDF
QSLVGDWRPIIDEIPNALVHEVKDLEFAAWLIEALCRVYGFRGLAIGFKTAHLIIENFWD
SLYPSPDDDDIEFRIASLIGLNGYDGDGALITPIMSIPITQDTSSGCYATWQYIRALDLS
RENEDKQRKKTDNGVISVEQINRAVSESSKEFYGELVEQLNSAIDEFEQLSKNMDRVMGQ
PQPTTAISKSLQKCLDSVKYLAADKLAVISSEVNDSIDINIDGETQTIGAVDNQLQTRQQ
VIRSLQQAAEFFRKTEPHSPMSYSLEQVIRWSSLTLPELLQELIDDSNSRNGYFKLTGIT
ETK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggactatgatgatataattgatttttcattactgataaaaaatgttaatgagttggct
ccttcaggggtcgatcctcgcacagatatatctccgagttctcagtattatcgattaaaa
gatattcgtagtaatgctagagcgaatgaacggaagttgctggtagaagaagatgacttt
cagtctttagttggggattggcgaccaattattgatgaaataccaaatgcacttgtgcac
gaggtaaaggatctagagtttgcagcttggttaatcgaagcattgtgtcgtgtttatggt
ttcagagggcttgcgattggctttaaaactgcgcaccttatcatagagaacttttgggat
agtttatatccgagtcctgatgatgacgatattgaatttcgcattgcatccttaattgga
cttaacggctatgatggtgatggtgcattaattacaccaattatgagtattccgattact
caagatacaagttctggttgttatgctacttggcaatatattcgagcattagacctatct
agagaaaatgaagataaacaacggaaaaaaacagataatggtgttataagtgtcgagcaa
attaatagagctgtttctgaatcctctaaagagttttatggggagttagttgaacagtta
aatagtgctattgatgagtttgaacagttatcaaaaaatatggatagagttatgggacaa
ccgcaacctaccacagccattagcaaatcactacagaaatgtcttgattctgttaaatat
cttgcggccgataaattggcagttattagttcagaagttaatgatagcattgatattaat
attgatggcgaaacgcagacaatcggtgctgtagataatcagctccaaacacggcaacaa
gttattagaagtttacagcaggctgctgaattttttagaaaaactgaacctcattcgcct
atgtcttattcactagagcaagttattcgttggagtagcttaactttgcctgagttattg
caagagcttatagatgatagtaatagtcgtaatgggtattttaaactaacaggcataact
gaaactaagtaa

DBGET integrated database retrieval system