KEGG   Shewanella baltica BA175: Sbal175_2055Help
Entry
Sbal175_2055      CDS       T02014                                 

Definition
(GenBank) type VI secretion protein, VC_A0110 family
  KO
K11896  type VI secretion system protein ImpG
Organism
sbb  Shewanella baltica BA175
Brite
KEGG Orthology (KO) [BR:sbb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sbb02044]
    Sbal175_2055
Secretion system [BR:sbb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Sbal175_2055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF
Motif
Other DBs
NCBI-ProteinID: AEG11323
UniProt: G0AY97
Position
2431048..2432877
Genome map
AA seq 609 aa AA seqDB search
MNDELLKYYNRELTFIRRMGAEFAEQYPKIAGRLRISEENVEDPHVSRLIEGFSLLTAQI
RQKLDDSFPEVTDALLGQLYPDYQAPIPACSILKLTSQNLSTSGVLVARGTEFETKTEGL
KNCLFQSCYDTEVLPLEVTKAEFKNAPFNAPTPNLKQPIKALVKLTLTCEFDTTEMHELG
VTRLRFYLNGQRHHVYPLYELLHRQVISIGVSASDEASIRYLQPRHIQQVGFGDNESVVP
YSQKSFSGYRLLIEQFLCPEKFLFIDLIDLDPNWHGIKDEFNLYFYLSEGAAELERHINA
DSFLLGCTPVINLFQQKLEPIKLVSSQYEYRLAASYLDADVCEIISIQDIRAYDPFGNEM
VLNPYYSQGHPAFSQQQNMFWHSRREFVNWAGGYSEAGTEVYLSIIDCQFKGMAIDGAEQ
DWVIQVNALCSNRNLPSYLPFGGGEPHFSIRSHVDIIKDVRCLIAPTSPVRPALKENTRW
QLVNHLTLMSFSGENALSQLQETLKLYDFRGAPESRSLIDGITAVTISNGTARVNQQGRV
AVCAGSDILIEFSQSSYAGTGVYFFAGILDIFFSQFAAINSYTRLSIKLRDQAQIYHTWP
ARVGTQVLL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatgaactcctgaagtattataatcgtgagcttactttcatacgtcgcatgggc
gcagagtttgctgagcaatatcccaaaattgcagggcgtttacgtatatcggaagagaat
gtagaagatccgcatgtctcacgattgatcgaaggtttttcgttactcactgctcaaatt
aggcagaaactagatgatagttttcctgaagtaacggatgcattattgggtcagctatat
ccagattatcaagcacccatcccggcctgctcgattcttaaattgacgagccagaatctt
tctacttctggagttctagttgctcggggaacagagtttgaaactaaaactgaagggctt
aaaaactgtttatttcaatcttgctatgatacggaagtgctacctctagaggtaacaaaa
gcagagtttaaaaacgctccgtttaatgctccaacaccgaacttaaaacagcctattaag
gcgcttgttaaacttacacttacttgtgaatttgatacgacggaaatgcatgagcttggt
gtgacgcgtttacgattttatttgaatggacaacgtcatcatgtgtatccgctctatgag
cttttacatcgtcaagttatcagtattggggtatctgcttctgatgaagcaagtattcgt
tatttacaacctcggcatatacaacaagtaggatttggtgacaatgagagtgtagtgcca
tatagccaaaaaagtttttcaggctatagattgcttattgaacagtttttgtgtcctgag
aaatttctatttatagatctaattgatttagatccaaattggcatgggattaaagatgaa
tttaatctatatttttatctttccgaaggcgctgctgaattagagcgtcatatcaatgcc
gatagttttttgcttggctgcactcctgtaattaacttatttcagcagaagctagagcct
atcaagttagtgtcttcacaatatgaatatcgtcttgcagcaagctatttagatgctgat
gtgtgtgaaattatatcaatacaagatattcgggcttatgatccttttgggaatgagatg
gttctgaatccttactatagtcaagggcatcccgcattctcccaacagcagaatatgttt
tggcatagtcgacgtgaatttgtgaattgggccggtggttattcagaggctggaactgaa
gtttatctgtcaatcattgactgtcagtttaaaggtatggctattgatggtgcagaacaa
gactgggtcattcaagttaatgcactatgcagcaatcgaaatttgccctcctatttacct
tttggaggtggggagcctcattttagtattcgtagtcatgtagacattattaaagatgtc
cgttgtttaattgctccgacctcgccagttaggcccgcattgaaagagaacacccgctgg
cagcttgtaaatcaccttacactcatgagtttcagtggcgaaaatgcattgtctcagtta
caagaaacattaaagttatatgattttaggggagcgccagagtccagatcgttgatcgat
ggaataaccgcagtaaccattagcaatggaacggcaagagttaaccagcaaggaagagtc
gctgtttgtgcaggctcagatattcttattgagtttagccaatcatcctatgcaggaacg
ggagtgtatttttttgcaggtattttagatattttcttttcgcagtttgctgcaataaat
tcttacactcgactctcaattaaattgcgtgatcaggctcagatttatcatacatggccg
gctagagtcggtactcaggtgttgctatga

DBGET integrated database retrieval system