KEGG   Shewanella baltica BA175: Sbal175_2058
Entry
Sbal175_2058      CDS       T02014                                 

Definition
(GenBank) protein of unknown function DUF796
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
sbb  Shewanella baltica BA175
Pathway
sbb03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sbb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Sbal175_2058
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sbb02044]
    Sbal175_2058
Secretion system [BR:sbb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Sbal175_2058
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AEG11326
UniProt: G0AYA0
Position
2436816..2437295
AA seq 159 aa
MQANTYLDYEGIKGEATAEAFKDMITVLSMDWGSQREISSHTGTAMDREASSTRLSDVVI
TKLQDKSSPDFFKEATIGKGKKAIFHITKQGDKIEEIMKIELTDAMVSSYHMSVSGDRPV
ETIVISYTELMMTVVPTDDKNNVSAPQVYGYSGVKGQKL
NT seq 480 nt   +upstreamnt  +downstreamnt
atgcaagctaacacatatttggactacgaagggattaaaggcgaagcaactgcagaagct
tttaaagacatgattactgttctatctatggattggggttcacaacgtgaaatctcttct
catactggtactgctatggatcgtgaagctagttcaactcgtttgagcgatgttgtcatt
accaagttgcaagataaatcttctcctgatttcttcaaggaagcgactattggtaaaggt
aagaaagcaatttttcatatcactaaacaaggtgataaaattgaagaaatcatgaaaatt
gaactaactgacgccatggtaagtagctaccacatgtcagtttctggtgatcgtccagtt
gaaacaattgttattagttatacagagctaatgatgacagttgtacctacagatgacaaa
aataacgtatctgcaccacaagtttatggttacagtggcgttaaaggccaaaagttataa

DBGET integrated database retrieval system