KEGG   Shewanella baltica BA175: Sbal175_2587Help
Entry
Sbal175_2587      CDS       T02014                                 

Definition
(GenBank) adenosylmethionine-8-amino-7-oxononanoate aminotransferase
  KO
K00833  adenosylmethionine---8-amino-7-oxononanoate aminotransferase [EC:2.6.1.62]
Organism
sbb  Shewanella baltica BA175
Pathway
sbb00780  Biotin metabolism
sbb01100  Metabolic pathways
Module
sbb_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:sbb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Sbal175_2587
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sbb01007]
    Sbal175_2587
Enzymes [BR:sbb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.62  adenosylmethionine---8-amino-7-oxononanoate transaminase
     Sbal175_2587
Amino acid related enzymes [BR:sbb01007]
 Aminotransferase (transaminase)
  Class III
   Sbal175_2587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AEG11838
UniProt: G0AR30
Position
3054459..3055826
Genome map
AA seq 455 aa AA seqDB search
MRNLLDFDFDSAHIWHPYTSMTRSLPVFGVHSAKGCELELVDGRKLVDGTSSWWACVHGY
AHPEILTAMEKQLHQLSHVMFGGITHEPAIELCKKLIAMTCEPLTKVFLCDSGSISVEVA
IKMALQYWQGQSLQGKNSQEQGAHEERPQKQRILTVKKGYHGDTFAAMSVCDPEGGMHTM
FGDALTKQSFVPAPQTAFGETLQTDDLTAMRSFLSANNHDIAAVIIEPIMQGAGGMRFYS
ADYLAGIRALCDEFDVLLILDEIATGFGRTGKLFAYEHANITPDILCLGKALTGGYISLA
ATLCTDKVAQGISQSPAGVFMHGPTFMGNPLACAAACASLDLINRNEWQAQVAAIEQQMR
LELKNAIDLPSVKDVRVLGAVGVLEMHDPVNTAELQQQFVDLGVWVRPFANLIYIMPPYI
ISPAQLSQLTGAMKQVAAGIRASSNSAEPQLISHG
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaatttactcgattttgattttgatagcgcccatatttggcatccttacacatca
atgacccgttctcttcctgtttttggtgtacatagcgcaaagggctgcgagctcgaactc
gtcgatggccgcaagctggtcgatggcactagctcatggtgggcctgtgtgcacggctat
gcgcatcccgagatattaaccgcgatggaaaaacagctgcatcagctgagccatgtgatg
tttggcggcatcacccatgaacccgccattgaactgtgcaaaaaacttattgctatgacc
tgcgagccgctgacgaaagtctttttatgcgactctggctctatctcagtcgaagtggcg
atcaaaatggcgttgcaatattggcaaggtcaaagtttgcaaggtaagaactcacaagag
caaggcgcacatgaagaacggccgcaaaaacaacgtattcttaccgttaagaagggttac
cacggcgatacctttgccgctatgagcgtgtgcgatcccgaaggtggcatgcacactatg
tttggcgatgcgcttacgaaacaatcctttgtgcccgcgccacaaaccgcctttggcgaa
accttacaaaccgatgatttaaccgctatgcgcagctttttaagtgcaaataaccatgat
attgccgctgttatcatagagccgataatgcaaggtgctggcgggatgcgtttttacagc
gcggattatttagcgggtattcgcgccctatgcgatgaatttgatgtgctactgatctta
gatgaaatagccactggctttggccgcacaggcaagctatttgcctatgaacacgccaat
atcactccagatatcttatgtttaggtaaagcgctcacgggtggttatatcagcctagcg
gcaacgctgtgtaccgataaagtcgcccaaggaataagccaatctcccgctggcgtgttt
atgcatgggccgacctttatgggtaacccgctggcctgcgcagcggcgtgtgcgagctta
gacttaatcaatcgcaatgaatggcaagcgcaagtggccgctatcgagcagcaaatgcgc
ttagaacttaagaatgcaattgatttaccgagtgtaaaagacgtgcgagtacttggggca
gtcggtgtgttagagatgcatgatcccgtcaataccgctgagctacagcaacaatttgtt
gatttaggggtgtgggttcgccccttcgctaaccttatctatatcatgccgccctatata
attagcccagcgcaattaagccaactcaccggtgcgatgaagcaagtggcagcaggtatt
cgcgcatcatcaaacagtgccgagccacagcttatcagtcacggttga

DBGET integrated database retrieval system