KEGG   Shewanella baltica BA175: Sbal175_2590Help
Entry
Sbal175_2590      CDS       T02014                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sbb  Shewanella baltica BA175
Pathway
sbb00010  Glycolysis / Gluconeogenesis
sbb00620  Pyruvate metabolism
sbb00640  Propanoate metabolism
sbb00680  Methane metabolism
sbb01100  Metabolic pathways
sbb01110  Biosynthesis of secondary metabolites
sbb01120  Microbial metabolism in diverse environments
sbb01130  Biosynthesis of antibiotics
sbb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sbal175_2590
   00620 Pyruvate metabolism
    Sbal175_2590
   00640 Propanoate metabolism
    Sbal175_2590
  Energy metabolism
   00680 Methane metabolism
    Sbal175_2590
Enzymes [BR:sbb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Sbal175_2590
Lipid biosynthesis proteins [BR:sbb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Sbal175_2590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEG11841
UniProt: G0AR33
Position
3061960..3063912
Genome map
AA seq 650 aa AA seqDB search
MSSQSLYKVSGNIAANALVNNDKYKTMYQESIVNPEGFWREHGKRIDWIKPYTKIKKTSF
DDHNLSINWFYDGTLNASANCLDRHLAEHSDRVAIIWEGDNASEQRKITYGELHAEVCKF
ANALRSQGVRRGDIVTIYMPMVPEAAVAMLACARIGAVHSVVFGGFSPDSIASRVIDGKS
KVIITSDEGMRGGRAIPLKRNIDDALKNPDVTTVEKVIVLKRTGGKVDWVEGRDVWWHSL
METASEYCQPEEMDAEAPLFLLYTSGSTGNPKGVLHTTGGYMVYASMTHEYVFDYKAGEV
YWCTADVGWITGHSYMVYGPLANGATVLIHEGVPNHPSPARLGEMIDRHKVNILYTAPTL
IRALMAEGKQHFDKFDGSSLRIMGSVGEPINPEAWRWYHEVIGHEHCPIVDTWWQTETGG
ILITPLPGATDTKPGSATRPFFGVQPALVDNMGNILEGENEGNLVLLDSWPGQMRTVYGD
HERFVLTYFKTFRGMYFTGDGARRDEDGYYWITGRVDDVINVSGHRLGTAEVESALVSHE
LVAEAAVVGYPHDIKGQGIYAYVTLTRGTEETEELRQELRQWVRKEIGALATPDLIQWAT
GLPKTRSGKIMRRFLRKIAANEVTNLGDASTLADPAVIETLIESRLNRTE
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgcagtctctctacaaagtctccggcaatatcgctgccaatgcacttgtaaac
aacgataaatataaaacaatgtaccaagagtcgattgtcaatcctgaaggtttctggaga
gaacacggcaagcgtattgattggataaaaccctataccaaaattaaaaaaacctctttt
gatgatcataacttatcgatcaactggttttacgacggcaccctaaatgcttctgccaac
tgtttagatcgtcacttagccgagcacagtgatcgcgtggcgattatttgggaaggcgac
aacgccagcgaacaacgcaaaatcacctacggtgaattacatgcagaggtgtgtaaattc
gctaacgcattacgcagccaaggcgtgcgccgcggtgacatagtcacgatttacatgcct
atggtgccagaagccgcagtggctatgctcgcctgtgcccgtatcggcgcggtgcactct
gtggtcttcggtggtttctcaccggactctatcgcctctcgcgtcattgatggcaaatct
aaagtcattattacctcagatgaaggtatgcgcggtggccgtgctatcccattgaaacgc
aacatcgatgatgccttaaaaaatcctgatgttactacggttgagaaagtcatagtgctg
aagcgcacgggcggcaaagtggattgggtagaaggccgagatgtgtggtggcactcactg
atggaaaccgcatctgagtactgccaaccagaggaaatggacgccgaagcgccgttattc
ctgctgtatacctcaggttcaaccggtaatcccaagggcgtattgcacaccactggtggc
tacatggtttatgcgtctatgacccatgagtatgtgttcgactacaaagcgggagaagtg
tactggtgtaccgccgatgtgggttggatcactggccactcttacatggtttacggccca
cttgccaatggtgcgactgtgcttatccatgaaggtgtaccgaatcatccaagccctgcc
cgtttaggtgaaatgattgaccgccataaggtaaacattctttacacagcgccaacctta
attcgcgcgctgatggccgaaggtaaacaacacttcgataagttcgatggtagcagcttg
aggattatgggctcggtaggcgaacccatcaacccagaagcatggcgttggtaccatgag
gtcataggtcatgaacattgccctatcgtcgatacttggtggcaaactgaaaccggcggt
attttgatcacgccgctacctggggcgaccgacactaaacctggttcagcgacccgtccg
ttctttggcgttcaacctgccttagtcgataacatgggtaacattttagagggtgagaac
gaaggtaacttagtgttactcgactcttggcctggccaaatgcggactgtgtatggcgac
cacgaacgattcgtactgacctactttaaaactttccgcggcatgtattttaccggtgac
ggtgcccgccgcgatgaggatggttactactggatcacaggccgcgtcgatgacgtaatc
aacgtatccggccacagattaggtacggcagaggtcgaaagtgcgctggtatcacatgaa
ctggttgcagaagctgcagtagttggctacccacacgatattaaaggccaaggtatttat
gcgtatgtcacgctaacccgcggcactgaagaaaccgaagagctacgtcaagagctgcgt
caatgggttcgtaaagaaattggtgcgctagccaccccagatctcattcaatgggcgacg
ggcttacctaagacacgttcaggcaagatcatgcgccgcttcctgcgtaagattgctgct
aacgaagtgaccaacttaggggatgcatcaaccttggccgatccagctgtgatcgagacc
ttgattgaatcacgcttaaatcgtacagagtaa

DBGET integrated database retrieval system