KEGG   Shewanella baltica BA175: Sbal175_2836Help
Entry
Sbal175_2836      CDS       T02014                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sbb  Shewanella baltica BA175
Pathway
sbb00071  Fatty acid degradation
sbb00072  Synthesis and degradation of ketone bodies
sbb00280  Valine, leucine and isoleucine degradation
sbb00310  Lysine degradation
sbb00362  Benzoate degradation
sbb00380  Tryptophan metabolism
sbb00620  Pyruvate metabolism
sbb00630  Glyoxylate and dicarboxylate metabolism
sbb00640  Propanoate metabolism
sbb00650  Butanoate metabolism
sbb00900  Terpenoid backbone biosynthesis
sbb01100  Metabolic pathways
sbb01110  Biosynthesis of secondary metabolites
sbb01120  Microbial metabolism in diverse environments
sbb01130  Biosynthesis of antibiotics
sbb01200  Carbon metabolism
sbb01212  Fatty acid metabolism
sbb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sbal175_2836
   00630 Glyoxylate and dicarboxylate metabolism
    Sbal175_2836
   00640 Propanoate metabolism
    Sbal175_2836
   00650 Butanoate metabolism
    Sbal175_2836
  Lipid metabolism
   00071 Fatty acid degradation
    Sbal175_2836
   00072 Synthesis and degradation of ketone bodies
    Sbal175_2836
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sbal175_2836
   00310 Lysine degradation
    Sbal175_2836
   00380 Tryptophan metabolism
    Sbal175_2836
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sbal175_2836
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sbal175_2836
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sbal175_2836
Enzymes [BR:sbb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Sbal175_2836
Exosome [BR:sbb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sbal175_2836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEG12076
UniProt: G0ATN9
Position
complement(3345636..3346826)
Genome map
AA seq 396 aa AA seqDB search
MSTEQLNQDIVIVAAKRTPMGGFQGNLSSVASPMLAATAIKGLLAETQLAGEHVDEVLMG
CVLPAGLGQAPARQATLGAGLPLSVGATTVNKVCGSGMKTVMLAHDLIKAGSAKVVIAGG
MESMSQAPYLLDKARGGMRMGHGKVLDHMFLDGLEDAYTGGAMGTFAQKTADEFGITREQ
MDAFALSSLEKANAAINSGAFKTEITPVTVSDRRGDVTIDTDEQPGNARPEKIPTLRPAF
TKDGTITAANSSSISDGAAALMLTSRGEADRLGLTVLATIKGHTTHAQEPSLFTTAPVGA
MAKLLANVGWSTDEVDLFEINEAFAMVTMLAVSELGLDIAKVNVNGGACALGHPIGCSGS
RLLVTLIHALKARGLKRGVASLCIGGGEATAMAIEV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgaacagttaaatcaagatatcgttatcgttgctgctaaacgcaccccaatg
ggcgggtttcaaggcaacttgtcatctgtagcatcacccatgttagccgcgaccgccatt
aaaggcttgttagcggaaacacaattggcgggtgagcatgttgatgaagtcttgatgggc
tgcgtattacccgcaggtttaggtcaagcgcctgcgcgtcaggcaactttgggtgcggga
ttacccttatccgttggtgcgaccacagtgaacaaagtctgtggttcaggcatgaagacg
gtcatgttagcccacgatttgattaaagcgggcagtgcaaaagtggtgatcgcaggcggc
atggaaagtatgagccaagcgccgtatttactcgataaagcccgcggcggcatgcgcatg
ggccatggcaaagtgttagatcacatgtttttagatggtcttgaagatgcctacacgggc
ggtgctatgggaacgttcgcccagaaaactgccgatgaatttggtatcacccgcgagcag
atggacgcttttgccctaagctcgcttgaaaaagccaatgccgcgattaactcgggtgcc
tttaaaaccgaaatcacccccgtcacagtcagtgaccgtcgtggtgatgtgactatcgat
accgacgagcaacccggtaatgcccgccctgaaaaaattcctacgctgcgccctgccttt
accaaagatggcactatcacagcggcaaactctagctctatttccgacggcgcagcggca
ttgatgctgacctcacgcggcgaagctgaccgtttaggcttaactgtattagcgactatt
aaaggccacacgactcacgcccaagagccttcattgttcacaactgcaccggttggcgct
atggcgaaattgctggccaatgtcggttggtcaacggacgaggtggatttattcgaaatc
aacgaagccttcgctatggtgactatgcttgctgtgtctgagctaggtttagatatcgct
aaggtaaacgttaatggcggcgcctgtgccttaggccatcctattggctgctcgggttca
cgtttgctggtgaccttaattcatgctttaaaagcccgcggcctgaagcgcggtgttgcc
tcgctgtgtatcggcggtggtgaagcgacggcgatggccatcgaggtttaa

DBGET integrated database retrieval system