KEGG   Shewanella baltica BA175: Sbal175_2970Help
Entry
Sbal175_2970      CDS       T02014                                 

Definition
(GenBank) Ribosomal RNA large subunit methyltransferase M
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
sbb  Shewanella baltica BA175
Brite
KEGG Orthology (KO) [BR:sbb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sbb03009]
    Sbal175_2970
Enzymes [BR:sbb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     Sbal175_2970
Ribosome biogenesis [BR:sbb03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Sbal175_2970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ
Motif
Other DBs
NCBI-ProteinID: AEG12209
UniProt: G0AVC3
Position
complement(3516745..3517830)
Genome map
AA seq 361 aa AA seqDB search
MKNLFLFCRAGFEKECAAEIQQRAGELNVGGFVKANNNDAYVVYQCFEDDAADTLVKQLP
LDSLIFARQMFAASDLLIDLPENDRISPIVAALSDVSKAGEVRVETPDTNEAKELSAFCR
KFTVPLRQHLKKSGSLLAQENPKRPIIHVCFIGPGRAYVGYSYSNNSSPHFMGIPRLKMA
ADAPSRSSLKLDEAFGQFVPKEEQEERIRSGMNSVDLGACPGGWTYQLVRRGMFVSAVDN
GPMDEKLMETGQVKHYREDGFRFEPQRKNIYWLVCDMVEKPARVAELIEAWAINGWFKEA
IFNLKLPMKSRYKEVTAILETMQTILKENGVSDFKVQCKHLYHDRDEVTVHLWLRPNTAW
N
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacctatttttattttgccgcgcaggctttgaaaaagaatgcgctgcagaaatc
caacagcgagccggtgagctcaatgtgggtggctttgttaaggccaacaataacgacgcc
tatgtcgtgtaccaatgttttgaagatgacgccgcagatacgttagtgaaacaactgcct
ttagattcgctcattttcgctcgccagatgtttgctgccagcgacttattaatcgacttg
cctgaaaatgacagaataagcccaatcgtggcggcactcagtgacgtcagcaaagcgggt
gaagtgcgggttgaaacgccagatactaacgaagcgaaagagctatcggctttttgccgt
aagttcactgtgcctttacgccagcatttgaaaaaatctggcagtttgctcgcgcaggaa
aatccaaaacgtccgattatccacgtgtgttttatcggacccggccgtgcctatgtgggt
tattcctacagcaataacagctcgccacactttatgggtattccgcgtctgaaaatggcg
gcggatgctccgagtcgttctagcctgaaactcgatgaagcctttggccaattcgtgcct
aaggaagagcaagaagagcgtattcgcagtggcatgaactcagtggatttgggcgcttgc
ccaggtggctggacttatcaactggtgcgtcgcggcatgtttgtgtcggctgtcgataat
ggtcccatggatgagaaactcatggaaacgggccaagtgaagcattaccgtgaagacggt
ttccgtttcgaaccacagcgcaaaaatatctattggctagtgtgcgacatggttgaaaaa
ccagcgcgcgtagctgaactgattgaagcttgggcgattaacggttggtttaaggaagcg
attttcaaccttaaattaccgatgaagagccgctataaagaagtcactgccattcttgag
accatgcagaccattcttaaagagaatggcgtgagcgattttaaagtgcagtgtaagcat
ctttatcacgatcgtgatgaagtgacagtgcatttatggctgcgtcctaataccgcgtgg
aattaa

DBGET integrated database retrieval system