KEGG   Shewanella baltica BA175: Sbal175_3241Help
Entry
Sbal175_3241      CDS       T02014                                 

Definition
(GenBank) oxaloacetate decarboxylase alpha subunit
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
sbb  Shewanella baltica BA175
Pathway
sbb00620  Pyruvate metabolism
sbb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sbal175_3241
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sbb02000]
    Sbal175_3241
Enzymes [BR:sbb01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Sbal175_3241
Transporters [BR:sbb02000]
 Other transporters
  Primary active transporters [TC:3]
   Sbal175_3241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 PTS_EIIA_1 MatP_C
Motif
Other DBs
NCBI-ProteinID: AEG12477
UniProt: G0AYB1
Position
complement(3844680..3846503)
Genome map
AA seq 607 aa AA seqDB search
MTFVSNSTTAVAKPLFLTDVVLRDAHQSILATRLRIDDMLPIAPLLDKIGFWSLESWGGA
TFDACIRYLGEDPWNRIRELKKAMPNTPQQMLLRGQNLLGYRHYADDLVTRFVERAHTNG
VDVFRIFDAMNDVRNLETAVKAVRQVGGHAQGTISYTTSPVHTIETWVDMAKRLEDMGCD
SLCIKDMAGLLKPMEAFELISRLKSQTQLALSMHCHATTGLSTATYQKAIEAGIDVLDTA
ISSMSQTYGHTATETVIAMVEDTERATGYDMVLLEEIAAYFREVRKKYAKFEGALKGIDS
RILRAQVPGGMLTNMESQLKEQGAANKMDLVLEEIPRVRADLGFLPLVTPTSQIVGSQAV
INVLMGERYKSLTKETEGVLKGEYGATPAPVDAALQARVLQGAEAITCRPADLLTPELAK
LRLELADKAQEQGIRLSSEHDDDVLTYALFPQIGLQFLKNRDDPSAFEPKPELTAALATN
AADRGPETYTVTVEGQEYVVKVATGGEISQIQPQGQSVHAVQTATASTTPMASHGEIRLE
MSAPLSGNIFKVHVSPGDRVCEGDVVIILEAMKMETEIRAQGDGIIAKLWVKEGDSVSVG
SQLLALA
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgacttttgtatctaattctacgacggcagtggctaagccattatttttaactgatgtt
gttttgcgggacgcgcatcaatccattttagcgacgcgcttacgcattgatgacatgtta
ccgatagcgccactactcgataagatcggcttctggtcactggaatcttggggcggtgca
acttttgatgcctgcattcgttatcttggtgaagatccttggaatcgaattcgtgagctg
aaaaaggccatgccaaatacgccgcagcaaatgttgttgcgtggccaaaacctcttaggt
tatcgccattatgccgatgatttagtgacgcgttttgttgagcgtgcccataccaatggc
gtcgatgtatttcgtatttttgatgcgatgaacgatgttcgaaacctcgagactgcggtg
aaagcagtgcgccaagttggcggccatgcgcaggggacgatttcgtataccacgagtcca
gtgcataccatagagacgtgggttgatatggcaaaacgtctcgaagatatgggttgtgat
tctttgtgcatcaaagatatggcgggtttgcttaaaccgatggaagcgtttgagcttatt
agccgactcaaatctcagacgcaacttgcgttatctatgcattgtcatgcgacgacaggg
ttgagtactgccacttatcagaaagccattgaagcgggcatcgatgtgctcgatacggca
atttcgtctatgagtcaaacctatggacatactgcaactgaaaccgttatcgctatggtg
gaagatactgagcgtgcaacgggttacgatatggtgttgcttgaggaaattgccgcttat
ttccgtgaagtgcgcaaaaagtacgctaagtttgaaggcgcgctgaaaggcatagattcg
cggatcttacgtgcccaagtgcctggtggcatgctgaccaatatggagagccaattaaag
gagcaaggtgcggccaataagatggacttggtcttggaagaaattccccgcgtacgtgct
gacttaggtttcttgccgttagtgacgcccacatcgcagattgtcggctcgcaggcggta
atcaatgtgctaatgggtgagcgttataagtcactgaccaaagagactgaaggcgtgctt
aagggcgaatatggcgcgacgcctgcgccagtcgatgccgcattgcaagcgagagtgctg
caaggagctgaagctattacatgtcgccctgcggatttattaacgccagagctggctaag
ttacggcttgagttagctgataaagcacaggaacaaggtattcgcctatcttcagagcat
gacgatgatgtgctgacctatgcactcttcccacaaataggattgcagttcttaaagaat
cgtgacgatccaagcgcctttgagcctaagcctgaattgactgcggcacttgctactaat
gctgcggatcgtggtcctgaaacctacacggtaacagtcgaagggcaagagtacgtagtt
aaagtcgccacaggcggggagatctcgcaaatccagccacagggccaaagtgttcatgcc
gtgcaaacggctacggcgagcactacgccaatggcgagccatggtgagatccggcttgaa
atgagcgcgcctctgtcgggcaacatcttcaaagtgcatgtttctccaggcgatagagtg
tgtgaaggcgatgtcgtgatcatccttgaggcgatgaagatggaaactgaaattcgtgct
cagggcgatggcattatcgctaagctctgggtgaaagaaggcgactcagtgtctgtgggt
tctcaattactggccttggcgtag

DBGET integrated database retrieval system