KEGG   Shewanella baltica BA175: Sbal175_4283Help
Entry
Sbal175_4283      CDS       T02014                                 

Definition
(GenBank) Lysophospholipase
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
sbb  Shewanella baltica BA175
Pathway
sbb00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sbb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Sbal175_4283
Enzymes [BR:sbb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Sbal175_4283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 DLH Abhydrolase_5 Esterase PGAP1 UPF0227 LIDHydrolase Peptidase_S28 Lipase_3
Motif
Other DBs
NCBI-ProteinID: AEG13500
UniProt: G0AWF6
Position
5029313..5030296
Genome map
AA seq 327 aa AA seqDB search
MSQAKATFSTEHDLNTSEQQAFWQSVVQDTLITADGITLAYMMVKHPQAHTAIVLSSGRV
ESYLKYQELVFDLYQQGYSVYAIDHRGQGLSDRMTINPHMGHVRRFNDYIDDFALFMQKK
VLPQNDKQLMLLGHSMGGAIGTLYLKQHPDIFTAAAFSAPMYGIKLPMPKAFVRWLASKL
DTTLNGGEPNYVLGGQNYKPVPFKGNELTHCQSRYQAYRDLYDAAPKLQLGSPTNRWLTE
SLDAADTCVLATAQIRTPILILQASEDKIVDNAAQNLAVSTHCQLKVIAGAAHEIFMEKD
AYRNQALNYALDFFKRYAIKDEDKQAG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagccaaagcgacattttcgactgaacacgatttaaatacctcagagcagcaa
gccttctggcaaagcgttgttcaagacacgctgatcacagctgatggcatcacgctggct
tatatgatggtcaaacatccccaagcgcataccgcaatcgttctcagtagtggccgagtt
gaatcctatttaaagtatcaagaattggtcttcgacttgtaccaacagggttactcagtt
tatgccatagatcaccgtggccaaggattgtcggatcgtatgacaatcaatccgcacatg
ggccacgtgcgaagattcaatgattatatcgatgattttgcactgtttatgcaaaagaaa
gtgttaccgcaaaacgacaaacaactcatgctacttggccattcaatgggcggcgcgatt
ggcactttgtatctcaaacagcatcccgatatttttaccgccgcggcattttcagcgccc
atgtatggcatcaaattacctatgccaaaagcattcgtgcgctggttagccagtaaactc
gataccactctcaatggcggcgaacctaactatgtgcttggaggacagaactataaaccg
gttcccttcaaaggaaatgagctaacccattgccaaagtagataccaagcctatcgagac
ttgtatgacgcggcccctaagttacaactcggttccccaactaaccgttggttgacagaa
tctttagatgcagcagacacctgcgtactggcaacagcgcaaattcgcacgccgatcctg
atactgcaagcgagtgaagataagattgttgataatgcagcccagaatcttgcggtgagc
actcattgccaattgaaggtgatagcgggggctgcccatgagatttttatggaaaaagac
gcctatcgaaaccaagccttaaattatgccctcgacttctttaaacgctacgcaataaag
gacgaggacaaacaagctggataa

DBGET integrated database retrieval system