KEGG   Shigella boydii CDC 3083-94 (serotype 18): SbBS512_E1251
Entry
SbBS512_E1251     CDS       T00700                                 
Name
(GenBank) putative phage regulatory protein, Rha family
Organism
sbc  Shigella boydii CDC 3083-94 (serotype 18)
SSDB
Motif
Pfam: Phage_pRha Phage_ASH P22_AR_C AIRC
Other DBs
NCBI-ProteinID: ACD06553
UniProt: B2TZ35
Position
1148982..1149830
AA seq 282 aa
MIISRPNIDSAISGRYTVSAPYKAGAGIGVLKFAHAHNRASAVFLRTFPHIQIMVGRAGA
SKDAPGSCATGYANPVRLTTSVIGVPCGEFSKFAHEDVTMATTPTQTHPKIDVIHGKAVT
SSLAVAEYFCKQHKNVIQKIQTLECSVEFTELNFQPSDYTDCTGRKLPCYQITRDGFAFL
AMGFTGKRAARFKEAYINAFNQMEKNLSGADAVDMSAVARNARGVYLHLREIHQIWTSQL
YPMLKAVESPLASKLYDRVGDAVFGAALVDSRLNGSDKEVRP
NT seq 849 nt   +upstreamnt  +downstreamnt
atgatcatttcaagaccaaatattgattctgcaatttcgggacgttacactgtctccgca
ccttataaagcgggtgccgggattggcgtcctgaaattcgcacatgcgcataaccgcgct
tcagcggtttttttgcgcacgtttcctcacatccaaattatggtggggcgtgcaggggca
tcgaaagatgcgccggggtcatgtgcgaccggttacgccaaccctgtacgtctcaccacc
tctgtgattggcgtcccatgtggtgagttttcaaaattcgcacatgaggatgtcactatg
gcaaccacccctacccaaactcaccctaaaattgatgttatccatgggaaggctgttacc
tcttctttggccgttgccgaatatttctgcaagcagcacaaaaacgttattcaaaaaatc
cagacgcttgagtgctctgttgaattcactgagctgaattttcagcccagtgattacacc
gattgcacaggccgcaaactaccttgctatcaaatcacccgcgatggcttcgcgttcctt
gctatgggctttactggcaaacgtgcagcccggttcaaagaggcatacatcaacgccttt
aaccagatggagaagaatttatctggtgctgacgcggttgatatgtcagctgtcgcacga
aacgccagaggcgtatacctgcatttgcgtgaaatccatcaaatctggacaagccagctt
tatccaatgcttaaggccgttgaatctccgctggctagcaaactgtacgaccgtgttggt
gatgctgtttttggcgctgcacttgttgattccaggctgaatggttctgacaaggaggtt
cgcccatga

DBGET integrated database retrieval system