KEGG   Shigella boydii CDC 3083-94 (serotype 18): SbBS512_E0319Help
Entry
SbBS512_E0319     CDS       T00700                                 

Gene name
phoR
Definition
(GenBank) phosphate regulon sensor protein PhoR
  KO
K07636  two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC:2.7.13.3]
Organism
sbc  Shigella boydii CDC 3083-94 (serotype 18)
Pathway
sbc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sbc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SbBS512_E0319 (phoR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbc01001]
    SbBS512_E0319 (phoR)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sbc02022]
    SbBS512_E0319 (phoR)
Enzymes [BR:sbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     SbBS512_E0319 (phoR)
Protein kinases [BR:sbc01001]
 Histidine kinases
  OmpR family
   SbBS512_E0319 (phoR)
Two-component system [BR:sbc02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   SbBS512_E0319 (phoR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoR HATPase_c HisKA PAS HATPase_c_2 HATPase_c_3 PAS_8 PAS_9
Motif
Other DBs
NCBI-ProteinID: ACD07193
UniProt: B2U404
Position
311382..312677
Genome map
AA seq 431 aa AA seqDB search
MLEWLSWKRLVLELLLCCLPAFILGAFFGYLPWFLLASVTGLLIWHFWNLLRLSWWLWVD
RSMTPPPGRGSWEPLLYGLHQMQLRNKKRRRELGNLIKRFRSGAESLPDAVVLTTEEGGI
FWCNGLAQQILGLRWPEDNGQNILNLLRYPEFTQYLKTRDFSRPLNLVLNTGRHLEIRVM
PYTHKQLLMVARDVTQMHQLEGARRNFFANVSHELRTPLTVLQGYLEMMDEQPLEGAVRE
KALHTMREQTQRMEGLVKQLLTLSKIEAAPTQLLNEKVDVPMMLRVVEREAQTLSQKKQT
FTFEIDNGLKVSGNEDQLRSAISNLVYNAVNHTPEGTHITVRWQRVPHGAEFSVEDNGPG
IAPEHIPRLTERFYRVDKARSRQTGGSGLGLAIVKHAVNHHESRLNIESTVGKGTRFSFV
IPERLIAKNSD
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtgctggaatggctgtcgtggaaaaggctggtgctggagctgctactttgctgcctcccg
gctttcatcctgggtgcattttttggttacctgccctggtttttgctggcatcggtaaca
ggactgcttatctggcatttctggaatttattgcgcctttcatggtggttgtgggtggat
cgcagtatgaccccgccaccggggcgtggtagctgggaaccgctactatacggcttacac
cagatgcagctgcgaaataaaaaacgccgccgtgaactgggcaatctgattaaacgcttt
cgtagcggcgcggagtcgctgcccgacgcggtggtgctgaccacggaagagggcggtatt
ttctggtgtaacggtctggcgcaacaaattcttggtttgcgctggccggaagataacggg
cagaacatccttaacctactgcgttacccggagtttacgcaatatctgaaaacgcgtgat
ttttctcgcccgctcaatctggtgctcaacaccgggcggcatctggaaattcgcgtcatg
ccttatacccacaaacagttgctgatggtggcgcgtgatgtcacgcaaatgcatcaactg
gaaggggcgcggcgtaacttttttgccaacgtgagccatgagttacgtacgccattgacc
gtgttacagggttacctggagatgatggatgagcagccgctggaaggcgcggtacgcgaa
aaagcgttgcacaccatgcgcgagcagacccagcggatggaagggctggtgaagcagttg
ctaacgctgtcgaaaattgaagccgcgccgacgcaattgctcaatgaaaaggttgatgtg
ccgatgatgctgcgcgttgttgagcgcgaggctcagactctgagtcagaaaaaacagaca
tttacctttgagatagataacggcctcaaagtgtctggcaacgaagatcagctacgcagt
gcgatttcgaacctggtctataacgccgtgaatcatactccagaaggcacgcatatcacc
gtacgctggcagcgagtgccgcacggtgccgaatttagcgttgaagataacggaccgggc
attgcaccggagcatattccgcgcctgaccgagcgtttttatcgcgttgataaagcgcgt
tcccggcaaaccggcggtagcggattagggttagcgatcgtgaaacatgctgtgaatcat
cacgaaagtcgcctgaatattgagagtacagtaggaaaaggaacacgtttcagttttgtt
atcccggaacgtttaattgccaaaaacagcgattaa

DBGET integrated database retrieval system