KEGG   Shigella boydii CDC 3083-94: SbBS512_E3016Help
Entry
SbBS512_E3016     CDS       T00700                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sbc  Shigella boydii CDC 3083-94
Pathway
sbc00071  Fatty acid degradation
sbc00280  Valine, leucine and isoleucine degradation
sbc00310  Lysine degradation
sbc00362  Benzoate degradation
sbc00380  Tryptophan metabolism
sbc00620  Pyruvate metabolism
sbc00630  Glyoxylate and dicarboxylate metabolism
sbc00640  Propanoate metabolism
sbc00650  Butanoate metabolism
sbc00900  Terpenoid backbone biosynthesis
sbc01100  Metabolic pathways
sbc01110  Biosynthesis of secondary metabolites
sbc01120  Microbial metabolism in diverse environments
sbc01130  Biosynthesis of antibiotics
sbc01200  Carbon metabolism
sbc01212  Fatty acid metabolism
sbc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sbc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SbBS512_E3016
   00630 Glyoxylate and dicarboxylate metabolism
    SbBS512_E3016
   00640 Propanoate metabolism
    SbBS512_E3016
   00650 Butanoate metabolism
    SbBS512_E3016
  Lipid metabolism
   00071 Fatty acid degradation
    SbBS512_E3016
   00072 Synthesis and degradation of ketone bodies
    SbBS512_E3016
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SbBS512_E3016
   00310 Lysine degradation
    SbBS512_E3016
   00380 Tryptophan metabolism
    SbBS512_E3016
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SbBS512_E3016
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SbBS512_E3016
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SbBS512_E3016
Enzymes [BR:sbc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SbBS512_E3016
Exosome [BR:sbc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SbBS512_E3016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ACD08517
UniProt: B2TYP6
Position
2811802..2812983
Genome map
AA seq 393 aa AA seqDB search
MKDVVIVGALRTPIGCFRGALAGHSAVELGSLVVKALIERTGVPAYAVDEVILGQVLTAG
AGQNPARQSAIKGGLPNSVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLTDSRTGAQLGNSQLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRQLQDAYAL
SSQQKARAAIDAGRFKDEIVPVMIQSNGQTLVVDTDEQPCTDASAEGLARLNPSFDSLGS
VTAGNASSINDGAAAVMMMSEAKARALNLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERVGWQLADVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRNARKGLATLCIGGGQGVALTIERDE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgttgtgattgtcggggcgttacggacacctatcggctgctttcgtggtgcg
ttagcgggtcattccgccgtggaacttggtagtttggtcgtgaaagcgttaatagaacgt
accggcgttcctgcatatgcggtggatgaagtaattcttggtcaggtgttgactgcaggg
gcagggcagaatccggcaaggcaatcggctattaaaggtggtcttcctaatagcgtttct
gcaatcactattaatgacgtttgcggttctgggcttaaagcactgcatctggctactcag
gcgatacagtgtggcgaggctgatattgtcatcgccggtggccaggaaaacatgagccgc
gcaccacatgttctgactgatagccgcaccggtgcacagcttggcaatagccagttggtt
gacagtctggtgcatgatgggttgtgggatgccttcaatgattatcatattggtgtcacc
gccgaaaatctggctcgcgaatatggcatcagccgtcagttgcaggatgcttacgcactt
agctcgcaacaaaaagcgcgagcggcgattgacgccggacgatttaaagatgagatcgtc
ccggtaatgatccaaagtaacggtcagacgttggttgttgataccgatgaacagccatgc
actgacgccagtgcagaaggtttagcccgtttaaatccttcatttgatagtctcggttct
gtgaccgcggggaatgcatcatccataaacgatggcgcagctgcggtaatgatgatgagc
gaagccaaagcacgagcgttgaatttacccgtgctggcccgcatccgcgcatttgccagc
gttggtgtagatccggcattgatgggaattgcgccggtgtatgcgacccgccgttgcctg
gagcgtgtaggctggcagttggctgatgtcgatcttatcgaggctaatgaagcgtttgct
gcacaggcgctttcggttggcaagatgcttgagtgggatgagcgtcgggtcaatgtcaat
ggtggcgcgatcgcactcggtcacccgataggcgcttccggttgccgaatcctggtttct
ctggttcatgaaatggtgaaacgtaatgcccgcaaagggctggcaacgctttgtatcggc
gggggccagggcgtggcattgaccattgaacgtgacgagtag

DBGET integrated database retrieval system