KEGG   Shigella boydii CDC 3083-94 (serotype 18): SbBS512_E3081Help
Entry
SbBS512_E3081     CDS       T00700                                 

Gene name
truC
Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
sbc  Shigella boydii CDC 3083-94 (serotype 18)
Brite
KEGG Orthology (KO) [BR:sbc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sbc03016]
    SbBS512_E3081 (truC)
Enzymes [BR:sbc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     SbBS512_E3081 (truC)
Transfer RNA biogenesis [BR:sbc03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    SbBS512_E3081 (truC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ACD10408
UniProt: B2TZE2
Position
2876353..2877135
Genome map
AA seq 260 aa AA seqDB search
MLEILYQDEWLVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGV
LLMGLSSEAGRLLAQQFEQHQIQKRYHAIVRGWLMEEAVLDYPLVEELDKIADKFAREDK
GPQPAVTHYRGLATVEMPVATGRYPTTRYGLVELEPKTGRKHQLRRHLAHLRHPIIGDSK
HGDLRQNRSGAEHFGLQRLMLHASQLSLTHPFTGEPLTIHAGLDDTWMQALSQFGWRGLL
PENERVEFSAPSGQDGEISS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaatactctatcaggatgaatggctggttgcggtaaataaaccctccggctgg
ctggttcaccgtagctggctggatcgcgacgagaaagtagtggtcatgcaaaccgtgcgt
gaccagataggacagcatgtttttactgctcatcgtctggaccgacccacttctggtgtg
ttgttgatgggattatccagcgaggccggacggctgctggcacaacagtttgaacagcac
caaatccagaaacgttaccatgcgattgtgcgcggatggttgatggaagaagcggtgctg
gattatccactggtggaagaactggacaaaatcgctgataaatttgcccgcgaagataaa
ggcccgcagccagcagtgacgcattatcgcggtctggcgaccgtagaaatgccggtagcg
accggacgttacccgaccacgcgctacggcctggtggaactggagccgaaaaccggacgc
aaacatcagcttcgccgacatcttgcccatttgcgtcatccgattattggcgatagcaaa
catggcgatttacgccagaatcgcagcggtgctgagcattttggcctccagcggttaatg
ctacatgccagtcagttgtcattgacgcatccttttactggcgagccgctgactattcac
gcgggcctggacgacacctggatgcaggcgttatcacaatttggctggcgcggtctgctt
cctgaaaatgaaagggttgagttcagtgcgccatcgggtcaggatggagagataagttcc
taa

DBGET integrated database retrieval system