KEGG   Shigella boydii CDC 3083-94: SbBS512_E4316Help
Entry
SbBS512_E4316     CDS       T00700                                 

Gene name
fadB
Definition
(GenBank) fatty oxidation complex, alpha subunit FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
sbc  Shigella boydii CDC 3083-94
Pathway
sbc00071  Fatty acid degradation
sbc00280  Valine, leucine and isoleucine degradation
sbc00281  Geraniol degradation
sbc00310  Lysine degradation
sbc00362  Benzoate degradation
sbc00380  Tryptophan metabolism
sbc00410  beta-Alanine metabolism
sbc00640  Propanoate metabolism
sbc00650  Butanoate metabolism
sbc00903  Limonene and pinene degradation
sbc00930  Caprolactam degradation
sbc01040  Biosynthesis of unsaturated fatty acids
sbc01100  Metabolic pathways
sbc01110  Biosynthesis of secondary metabolites
sbc01120  Microbial metabolism in diverse environments
sbc01130  Biosynthesis of antibiotics
sbc01200  Carbon metabolism
sbc01212  Fatty acid metabolism
Module
sbc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sbc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SbBS512_E4316 (fadB)
   00650 Butanoate metabolism
    SbBS512_E4316 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    SbBS512_E4316 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    SbBS512_E4316 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SbBS512_E4316 (fadB)
   00310 Lysine degradation
    SbBS512_E4316 (fadB)
   00380 Tryptophan metabolism
    SbBS512_E4316 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SbBS512_E4316 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SbBS512_E4316 (fadB)
   00281 Geraniol degradation
    SbBS512_E4316 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SbBS512_E4316 (fadB)
   00930 Caprolactam degradation
    SbBS512_E4316 (fadB)
Enzymes [BR:sbc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SbBS512_E4316 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SbBS512_E4316 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SbBS512_E4316 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     SbBS512_E4316 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ACD09318
UniProt: B2TVJ5
Position
complement(4033373..4035562)
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGEAIGVLEQQSDLKGLLLRSN
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALK
IGLVDGVVKAEKLVEGAKAVLRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVK
GKAKKLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQKVRP
DTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSKGKP
KKEEDAAVEDLLAEVSQPKRDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPPVEPA
RPVGDLKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctttacaaaggcgacaccctgtaccttgactggctggaagatggcattgccgaactg
gtatttgatgccccaggttcagttaataaactcgacactgcgaccgtcgccagcctcggc
gaggccatcggcgtgctggaacagcaatcagatctaaaagggctgctgctgcgttcgaac
aaagcagcctttatcgtcggtgctgatatcaccgaatttttgtccctgttcctcgttcct
gaagaacagttaagtcagtggctgcactttgccaatagcgtgtttaatcgcctggaagat
ctgccggtgccgaccattgctgccgtcaacggctatgcgctgggtggtggctgcgaatgc
gtgctggcgaccgattatcgtctggcgacgccggatctgcgcatcggtctgccggaaacc
aaactgggcatcatgccgggctttggcggttctgtacgtatgccacgtatgctgggcgct
gacagtgcgctggaaatcattgccgccggtaaagatgtcggcgcggatcaggcgctgaaa
atcggtctggtggatggcgtagtcaaagcagaaaaactggttgaaggcgcaaaggcggtt
ttacgccaggccattaacggcgacctcgactggaaagcaaaacgtcagccgaagctggaa
ccactaaaactgagcaagattgaagccaccatgagcttcaccatcgctaaagggatggtc
gcacaaacggcggggaaacattatccggcgcccatcaccgcagtaaaaaccattgaagct
gcggcccgttttggtcgtgaagaagcattaaatctggaaaacaaaagctttgtcccgctg
gcgcacaccaacgaagcccgcgcactggtcggcattttccttaacgatcaatatgtaaaa
ggcaaagcgaagaaactcaccaaagacgttgaaacaccgaaacaggccgctgtactgggc
gcaggcatcatgggtggcggcattgcttaccagtctgcgtggaaaggcgtaccggttgtc
atgaaagatatcaacgacaagtcgttaaccctcggcatgaccgaagccgcgaaactgctg
aacaagcagcttgaacgcggcaagatcgatggtctgaaactggctggcgtgatctccacg
atccacccaacgctcgactacgccgggtttgaccgcgtggatgttgtggtagaagcggtt
gtcgaaaacccgaaagtgaaaaaagccgtactggcagaaaccgaacaaaaagtacgcccg
gataccgtgctggcgtctaacacttcaaccattcctatcagcgaactggccaacgcgctg
gaacgcccggaaaacttctgcggaatgcacttttttaacccggtacaccggatgccgttg
gtagaaattattcgcggcgagaaaagctccgacgaaaccatcgcgaaagttgtcgcctgg
gcgagcaagatgggcaagacgccgattgtggttaacgactgccccggcttctttgttaac
cgcgtgctgttcccgtatttcgccggtttcagccagctgctgcgcgacggcgcagatttc
cgcaagatcgacaaagtgatggaaaaacagtttggctggcctatgggtccggcatatctg
ctggatgtcgtgggcattgataccgcgcatcacgctcaggctgtcatggcagcaggcttc
ccgcagcggatgcagaaagattaccgcgatgccatcgacgcgctgtttgatgccaaccgc
tttggtcagaagaacggcctcggtttctggcgttataaagaagacagcaaaggtaagccg
aagaaagaagaagacgccgccgttgaagacctgctggcagaagtgagccagccgaagcgc
gatttcagcgaagaagagattatcgcccgcatgatgatcccgatggtcaacgaagtggtc
cgctgtctggaagagggcattatcgccactccggcggaagcggatatggcgctggtctac
ggcctgggcttccctccgttccacggcggcgcgttccgctggctggacaccctcggtagc
gcaaaatacctcgatatggcacagcaatatcagcacctcggcccgctgtatgaagtgccg
gaaggtctgcgtaataaagcgcgtcataacgaaccgtactatcctccggttgagccagcc
cgtccggttggcgacctgaaaacggcttaa

DBGET integrated database retrieval system