KEGG   Shigella boydii CDC 3083-94 (serotype 18): SbBS512_E4432Help
Entry
SbBS512_E4432     CDS       T00700                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
sbc  Shigella boydii CDC 3083-94 (serotype 18)
Pathway
sbc00561  Glycerolipid metabolism
sbc00640  Propanoate metabolism
sbc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SbBS512_E4432 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SbBS512_E4432 (gldA)
Enzymes [BR:sbc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     SbBS512_E4432 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ACD09806
UniProt: B2TWE3
Position
complement(4138524..4139627)
Genome map
AA seq 367 aa AA seqDB search
MDRIIQSPGKYIQGADVINRLGEYLKPLAERWLVVGDKFVLGFAQSTVEKSFKDAGLVVE
IAPFGGECSQNEIDRLRGIAETAQCGAILGIGGGKTLDTAKALAHFMGVPVAIAPTIAST
DAPCSALSVIYTDEGEFDRYLLLPNNPNMVIVDTKIVAGAPARLLAAGIGDALATWFEAR
ACSRSGATTMAGGKCTQAALALAELCYNTLLEEGEKAMLAAEQHVVTPALERVIEANTYL
SGVGFESGGLAAAHAVHNGLTAIPDAHHYYHGEKVAFGTLTQLVLENAPVEEIETVAALS
HAVGLPITLAQLDIKEDVPAKMRIVAEAACAEGETIHNMPGGATPDQVYATLLVADQYGQ
RFLQEWE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcattattcaatcaccgggtaaatacatccagggcgctgatgtgattaatcgt
ctgggcgaatacctgaagccgctggcagaacgctggttagtggtgggtgacaaatttgtt
ttaggttttgctcaatccactgtcgagaaaagctttaaagatgctggactggtagtagaa
attgcgccgtttggcggtgaatgttcgcaaaatgagatcgatcgtctgcgtggcatcgcg
gagactgcgcagtgtggcgcaattctcggtatcggtggcggaaaaaccctcgatactgcc
aaagcactggcacatttcatgggtgttccggtagcgatcgcaccgactatcgcctctacc
gatgcaccgtgcagcgcattgtctgttatctacaccgatgagggtgagtttgaccgctat
ctactgttgccaaataacccgaatatggtcattgtcgacaccaaaatcgtcgctggcgct
cctgcacgtctgttagcggcgggtatcggcgatgcgctggcaacctggtttgaagcacgc
gcctgttcccgtagcggcgctaccactatggcgggcggcaagtgcacccaggcggcgctg
gcactggcagaactgtgctacaacactctgctggaagaaggcgaaaaagcgatgcttgcc
gccgaacagcatgtagtaacccctgcgctggaacgcgtgattgaagcgaacacctattta
agcggtgttggttttgaaagcggcggactggcggcggctcatgcggtgcataacggcctg
accgctatcccggacgcgcatcactattatcacggtgaaaaagtggcattcggtacgctg
acgcagctggtactggaaaacgcgccggttgaggaaatcgaaaccgtagctgcacttagc
catgcggtaggtttgccaataactctcgctcaactggatattaaagaagatgtcccggcg
aaaatgcgaattgtggcagaagcggcatgtgcagaaggtgaaaccatccacaacatgcct
ggcggcgcgacgccagatcaggtatacgccactctgctggtagccgaccagtacggtcag
cgtttcctgcaagagtgggaataa

DBGET integrated database retrieval system