KEGG   Sphingobium baderi: ATN00_01460Help
Entry
ATN00_01460       CDS       T04194                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
sbd  Sphingobium baderi
Pathway
sbd03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sbd00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    ATN00_01460
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sbd03011]
    ATN00_01460
Ribosome [BR:sbd03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    ATN00_01460
  Bacteria
    ATN00_01460
  Archaea
    ATN00_01460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ALR19171
UniProt: A0A0S3EUR7
Position
complement(274443..274829)
Genome map
AA seq 128 aa AA seqDB search
MSKEKAPRRVADNEALAVGTQIRGSAQKLNLVAALIRGRKVEDALNVLTFSKKAMAVDVR
KVLASAIANAENNHNLDVDALVVAEASVGKSFTLKRFHARGRGKSTRILKPFSRVRIVVR
EAGEEAEA
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggaaaaagctccccgtcgcgtcgccgacaatgaggcgctggccgttggcacg
cagattcgcggttcggcccagaagctgaacctggtcgccgcgctgatccgtggccggaag
gtcgaggacgcgctcaatgtgctcaccttctcgaagaaggcgatggccgtcgacgtgcgc
aaggtgctggcctcggccatcgccaatgcggaaaacaaccacaatctggacgtcgacgcg
ctggtcgtcgcggaagcatcggtgggcaagagcttcaccctgaagcgcttccacgctcgc
ggccgcggcaaatcgacccggatcctcaagcccttcagccgcgtacgcattgtcgtgcgt
gaagctggcgaagaagcggaggcgtaa

DBGET integrated database retrieval system