KEGG   Sphingobium baderi: ATN00_07855Help
Entry
ATN00_07855       CDS       T04194                                 

Definition
(GenBank) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
sbd  Sphingobium baderi
Pathway
sbd00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sbd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ATN00_07855
Enzymes [BR:sbd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     ATN00_07855
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     ATN00_07855
    1.1.1.-  
     ATN00_07855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 FAD_binding_2 Pyr_redox_2 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ALR20231
UniProt: A0A0S3EXY8
Position
complement(1577087..1577983)
Genome map
AA seq 298 aa AA seqDB search
MAEGHSYAFDDGAVPGHEVAGEVVATGTGVENLAIGDHVAVLPFLTCGECVACKTGDAVG
CTAFGMFGAFGVTGGYAEYLLTNALWCVNLPRSLSFDDGALVEPLAVSLRAVRASGIQSG
DRVLVMGAGAIGLAAAYWARLSGAERVVMSATSDRREEIARAIGVDAFILPEEGRTFAEQ
SAEALGRPADIVFECAGVAGSLDQAVSAVRRRGMIAAPGFCWMPDTFSAMPAMMKEATIR
YTNMYDTREFEIAIGALDNGHVEPRAMITDTVPLDNAPAMFEELRGRNNHCKVMIKPW
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaggacacagctacgctttcgacgacggcgcggttcccggtcatgaggttgcg
ggcgaagtggtggcgacgggcaccggtgtcgagaaccttgccattggcgatcatgtcgcg
gtcttgcctttcctgacctgtggcgaatgcgtggcctgcaagacgggcgacgcggtcggt
tgcacggcattcggcatgttcggcgcatttggagtgacggggggctatgccgaatattta
ctgactaacgcgctctggtgcgtgaacctgccacgttcgctgagtttcgacgatggagcg
ttggtggagccgctggcagtgtcattgcgtgccgtgcgcgcttcgggaatccagagcggc
gatcgcgtgctcgtcatgggcgcaggggcgatcgggctggccgccgcttattgggcgcga
ctttccggcgctgaacgagtcgtgatgtccgccacctctgaccgccgagaggagatcgcg
cgggcaattggcgtcgacgcattcatcctgcccgaggaagggcgcacctttgcggaacaa
agcgcggaagcgctcgggaggcccgccgacattgtattcgaatgtgctggcgtcgccggt
tcgctcgatcaggcggtctccgcggttcgtcgccggggcatgatcgccgcacccggcttc
tgctggatgccagacaccttctcggccatgccagccatgatgaaagaggcgacgatccgc
tataccaacatgtacgacacacgcgagttcgagatcgccatcggcgcgctcgacaacggg
catgtggaaccgcgagccatgattaccgacaccgtcccgctcgacaatgcgcctgccatg
ttcgaggaactgcgcggccgcaacaatcactgcaaggtgatgatcaagccttggtga

DBGET integrated database retrieval system